• No results found

ANUVAD KI BHASHAVYGYANIK SAMASYAYEM

N/A
N/A
Protected

Academic year: 2022

Share "ANUVAD KI BHASHAVYGYANIK SAMASYAYEM"

Copied!
202
0
0

Full text

(1)

aiflfilaaftmwlfiarfilmunzaré

ANUVAD KI BHASHAVYGYANIK SAMASYAYEM

Tlwsis submitted to

COCHIN UNIVERSITY OF SCIENCE AND TECHNOLOGY

for the degree of

DOCTOR OF PHILOSOPHY

By

BABU K. VISWANATHAN

DEPARTMENT OF HINDI SCHOOL OF LANGUAGES

COCHIN UNIVERSITY OF SCIENCE AND TECHNOLOGY

KOCHI — 682 022

2000

(2)

DECLARATION

I here by declare that the thesis entitled ‘ANUVAD KI BHASHA VYGYANIK SAMASYAYEM’ has not previously formed the basis of the award of any degree, diploma, associateship, fellowship or other similar title or recognition.

Department of Hindi “ o 9:

School of Languages BABU K. VISWANAT AN

Cochin University of Science and Technology Cochin — 682 022

(3)

CERIFICATE

This is to certify that this thesis entitled ‘ANUVAD KI BHASHA VYGYANIK SAMASYAYEM’ is a bona fide record of work carried out by Mr. BABU K.

VISWANATHAN under my supervision for the Degree of Ph. D and no part of this has hither to been submitted for a degree in any university.

Department of Hindi O O 0 c7—0

School of Languages DR. N.G. DEVAKI

Supervising Teacher Cochin University of Science and Technology

Cochin — 682 022

(4)
(5)

3'53‘?

mmn§uIa%HBifi%,wTaTa#arfi1a?5$zfi‘a?ra1§%gHanmmm

=¥IE?fi%Is;$i?a”r%1TwTQ$2fi,fifiFrn§ErHa31fi$%rwmTfiéTzwq,

aHafiu°rf?taHg1%‘uTsfia:rfiaf%an1T619ra1na3TsHafiarIa3uamTE{aa aa?fin'§aEr3Tafi%31§1€q%nuTI¥=fifi?‘a‘HHnTé:wf%a'af?rawf13tH319r afiIa'Hu$r?i'3WrH%:ars.‘aTq1HTa?r¢RHR'ffisaB1?r%1TqTaaTGfiqa1, fi$1¥ra?raiTarf€fi63W3,=§%,a€%3H$r'naivIH1?naH¢&T’-93nHf3Ia?, 3aTf?t?.',afiFfia?rm9r1%$‘3n'f%3»3‘z1E%fi=¥wTwT%?uaiviH1?n$qaI$r aTfi2h1vra°r‘e'?Ha»?tT%afi?a1§1,a1a'%#°rs?WrQEfiHBfi*;[Ufqa?~;%I

svfifiéaézazfifiamwmmfiagwwmneamqfiaaw

%Ia1m1%1$,HTa:f?fi,aTsff%$,21%1:fi1%ra:,a11?:'mfiaiaTI¥agErraaT

n€ErsaHTaamaT2BT%fi:a13a'm§zaIwuwaaTqa:a1nmr«rnwT%I

f%Ta°r-sifififisagirrz %=rf%qTsa‘I¥Ifi‘rEu’s?T€f%H=“r~=Tz9r%1°r26?rr%f%:

m1wqTf%T<"r37f%$rH%H1a%f=¥s1a'<iarrq$r3?aa:a61ImTHT$ra?raT aafiFr%Ia’rs41wTa1Tzrr-?a’r%1TwTafi€sm3arT%:aIfia'awfiI1I2=4T1?:'a fiR73'd1fiT31§31?Qfi3fi11BmW1fi{$3fi‘f%l’3¥3TW7fiHEfi"1“f5Ifi$T3fiT ar<7IT%a?§afiaTqswTwTafi%vf%t$r11%:¢f%wTsa‘I¥%fi314%srarsia1=rarw

(6)

nEF=F1°faTs°f€rIwTqT§fiT31EIFIH%wf%r9fi1mfi%:nw=¥aTaTnir%a'€r 'a4j;aIaa%?wTwrés1Tf?i$HmaTrZT'aTq$f%q'a3H%r$ra1T%rR%'lu$riHT%%

5fiuT2fiui4"TwTws'%fiais=rr%rI%Tnfit:sI§firaa?rmm?rr%:¢fi‘§tea1?f

%1TmfiaTfi%Ha?a1°fa?r%fia'§'aaé?%1fh$r1E?fi%Iafi9§5nTwTf%I31TM¥

a1afi.*a1f;aTE§;a?I?q%Hqa‘aIf%1ia?ruTwTf%Ia1wfiHERTaEwa1?r§;q amHTea“<aqf?rf"?it?ra5I€raT%Is11sr<i1TI3iIrs’%fiafiTG1TWiT%f‘&:

wTwTf%$I1?r%mfi¢&1°f$ra1f;a1a'%a1?I3aaTzfiuTm?$rIaT1#EiHHi=‘T

%I%aI?r,mE.*,ar2f,2€wmaw,f%1fian‘f%%mTf%a1?%mg'aaFefi%?9'g'a wafia#fi3?£a3,a'IEa?rf%I1‘§‘I12HTaTa7raI%aaWaH%arI?fi$1¥m7}a:r, sfiaT2ff9r3H§rH-srai1I%7nT%2z112=‘rnIITHf3FaT%I

sregfisfiw-9a?u'ۤ:armWTfr'fiVfi5{\

§‘T¥T3TEIl1'J$TH11T'31§31?3fiT31TNTfi?I'H'%|31§H1?3?i?5WqT

na:me1afi§q,aH%f%‘f%‘a9$R’f$rqfiHwé?r§'q,%1TwT%:3aTf?Ia:

arsuaW3HiaVfI¥aga'IEa»°rf%u‘f§'I12aTa¥a$rHns1?r$r,sH3rsaW=¥

5flu1?fi9rsRIm%a,T%I

sfixI—9aveIaz"rfEFfi'qarau11I%'a1§1,araaETaa'1?1=3s1Tfi1$am=11{rI

aI§m'%:n1iWfi9gafira$rfifia1?fiHw1waf%a¥,am1wawWaf%aT,

(7)

f*fi$rsa'f?1wT,f?1fi1fi1‘fiwsafiaTafiHafaRfi§qfi~rf%fi,n?fia$qéwsfi=fi ag?IE3Wf%qTsa‘I¥a§a1?a»°rHmaTaTa#f%r3*€I1‘?1fi$2%raHrsHaI%aW fi"rrI‘r%1T2fiarrsm11H€T%I

'a1§a1?a?Tm€a'%$1Tfi1$Q?'3nf€§3ITI%a?H14??4T':Tmn$E;?fi1IaIsa1wI¥

31?='Qfi‘3T?fqTH1WHTWfii1T3R€|”§QS1?q'3fi'¢Fi‘VWWQfi‘3F%fi'f'3'U uE6R,a§;?IEé?n11w1¥ng?5firqGrIfia1€rmaTa?fiIHTf%tf€1a'T,na—afi«1T Q?'31'§H1E,3T?fQ?'3F@fiWfifil$Tf?lE1fi,31§?l?3?§?W15°flEQ‘fWf, w2f—f?rufTwa%f%'I%'awni%m¥,mf%:1%*f3mn$RQET3I1?I?an1%f%rf3:$r g:°frRfi*:v:Frfi1fiTa‘°r=1’s‘%I

vfiU9ii%I%?H§;*2faIsuW$rmw‘agaTaa?ri€q=iaTf?IH?¥rWi2rr3'%I mi-afiqa‘¥iEiH—a?q'q?f%%I1Tan?r§q,%1TwT=¥%1ii*1H?afia?rnBEI11uf

%;Fhfi¢ra?TaT$aa?s1a%r§"q$Ifi,g?w,fi—'Iw,aawq?a?I1$—fiV1‘f?t?mH:

z123f1¥a1§ErIEa$ramaTa1°ffian31?ra%¥,3H3I%u11II¥m¥uwfi9ra»°rf§13T a?r%I

'aI§firI?au‘?a1a=:=i3ITt?I$amaTE'a1m5da11aIsu1w1¥rfi11T21Ta$r a?rf31wma=I-%3zQa‘zifiIHT,a1aw-f?1nfwa9rf%'f%‘Hqa'f%a¥,amw—zaaT a¥wa=1t,a1a=r%:31amr,arrEfiQa‘%fiafrz1fiHTaz1fi‘f%‘t*3:$rg:Tq?

(8)

§fQ'f3f&3W$?F?§Q,GH'3?F?E‘f3?f3fi31?35TUFET3fi3fi‘HF5TWTI€f§‘l

'3I3,?IEQEff%1'ffi'f%Ia1H‘mm73IBaWI¥f%rfia?rg'f%fif%7q°r,ai13$fi

%mT3fiafif3rf§Tt2aTaTafi’an'a%r$Tnu1HaRfi‘§"q,finfiQa‘#nIfi1%r1?1‘

?=b°r¢rIWREHgaHTan9r$rn'aWi%rmnaT%I

sfitrsra=er%?s1?r1?fa'¢<#61'<'=I1§?rf%aTrraT%a1‘r?s'rTera?rmafi?r

§fiTf3ifi?WWlFfi@fi?1'§ffiT|1f$W3?3fiHRHEW?FHW1fifi3fi§?f1fi"9H§%|

sfiHTfiQHTfifi3‘a1HTH'a°f&sTa1fiT1%aH$ra?ml1U1fi?Hq»?«ra=rm1T

%I1%=:aaTsm¥s?maT%',a14-a:r§fi:m°ra%fitmz%asrqé121a‘ai%Im%a12fi s'Ha1aH?a?r3wa1w3wa11%Ha¥%:wl‘@ran=fi3u?IE1aTHafi.'ar#r%f%‘11:3fi ar<1ET'a‘f?rr%i=‘r3rIirsaH%geaa5f9r7aw1a1¥3I%amramIw?GrmarR°r éT%,§?1Wf%HT%Iaw=fiHfiH-fi%f§IfifisT.qH.Gfiéafifi%€f%Ififi€'5r qa‘H%II17I%wi%rwq?figfiIafiT,wazmqa‘q€Hma#mE.'a?s.'an9ra?rf%rfEI vfi11T2fiH%TGrmm,afir:u€au3HT€Fu'1Han?fi1T%f%':"I1$arfif%ra1a1vi"I

9fi1arsIEi1II?fan1Pr'e.;%§f%1J’f3?f‘o‘fqFfi‘e1T2fi&TnTsIT%fi%I

area’!

a1§.%f%»a'rrm=r afif%a=rf%a1=ra

fiafifiafifivfimaw

EFTf%IT-r- 682022

(9)

firwgaznfim

fiw aiaafiafiwmfimfimawwré

‘31fi‘F=lw‘f

!€RI'¥f3T*l1'l?f:3fi7=l'l3'3fi1'5Tr5lTfi‘?l17r

a1§a1H23rFrrcq1f—srg;aw aE’rf%‘i*‘3=:$r=rfi‘%Tr1‘1T§-3Ti1,'Err?:%

sm:r?—%nwT%7a731Tf‘?1$aIsa1Fr$Tn3?cr—%nwTf‘a311?r%:

smrI—a1-;1a1a'r:a‘%1T6rra7r33=ITi?1$sI%2Eu=r-a1§fiI?.'a?r Efiwi-f-irtasrsf

fiafiwwwm-aaafifiafifimfiwmwfi

eafira?rrrf%%1TwT—aFfi'I?fisrgfiafiaT%nHnT­

aE;¢ra%?9E6I?qa‘a'f%—1%rfiafisaaTaQa‘sa1?r-niffam a1=fiII:'qa‘afir—=Tsrfi=Frs1‘;17=ITa'I:a‘eHf?r—sa'ffi1xr:¢,

9TEfi9fWfi'3fiGT,3?1'°3I?fifi%IE3T|T-31'3'31?9I?§?41T1¥§'3',?fi firqG*rI=3Ia1?«T91E°fa$r2aHTf?:“f%I'a“f-s1?:',a»T~rr,Qa'a1§aTa -3T?-f‘1_3'3?1'@'%fiE'fi"lETfi-3lfi7=I17:'3?Sl?H‘TT13;E1EU,ii' arvf-aIvff?I%fi'<0Ta?rf%1%I1InvTrf%a11”T-ar2f%:f€u‘fiI$rsra7r“<

qa'a1'§;a1a'-sIaqa‘a1*afi%t?rra'%Hia%fI¥a1§;araz1Ei%fig»—a¢

fifi‘rtza1?‘r'-firm?

gwtrw

1-18

19-48

49-87

(10)

a§'zfarea1u:aa73'a'IHa‘&2aw?§?I1fita;aw1=:rrZ1

2atra91T'3'?-ar§;'a1?.'€i?:I1a'1Tfi‘"<€trfi?ITa:rI4'a'c—q'—

1ia%IH==ITé?a1f1a'I?5lH1aVf1¥$R~T,g$w,f%‘hT,aa=r,qaf au'I1‘et:—f€IVrf%?a'T—*<atrI%?rI=réH1mfI3fs1?a'H:s:%firIR”4‘

3TEI,7='T_'<'(?1fiT-;,7:f¢WFr-l%"371‘5l'“T-13??-1T 1'?t»‘*~1Tf‘3I"1‘rlSr0T

a11fi‘)-"<€q'Ga'?ITQa‘31ga'I7:'%:21a"3fI3fg=Ts=a3\=11§rra1?f­

Prams?

fiawaww-aaafiafiamfimfiwmwfi

a1a2ra?r¢fi‘s1T6ITqa'fé‘f§rr~=:HTIZ+-a1aIr—%3a’qa‘zifi?1T—

mwfiwfiafififiawafifiafitagaw-mm firm

€I9snHr?qa'a131,a'I7:'-a1a=2I%s31a'aHa?4Ta1§;7=rIz'-sfi1,a'I'q'

fifaTazra‘?rErB‘Pr U751 ‘3fi?R°rH'fi=IT - mefixffiawéi

wfiwséfiagawafigwfifirwmfi-fiesé wswmwzafiafiqéfilfifiaw

31=f:rfi%9$Rqatfi4fi—fin=rf%rfi-éa=rmfrfi~Ifi­

f%7<a°r,31'I3?vFrs11wTrZTa'f%1f?r—2°r1Frq%f=rn1fifi‘rf?rafi

‘{1TFTfi7=F §?~l7lT-‘1fi‘7=l?1T-|"I7=1‘If?3E‘7ffi§'f%fi?I111'fi'

%I‘f?r—firG56f

GWEN

armwa:-=,1'*2I—

88-131

132-163

164-174

175-177

178-181

(11)

933313313

3fiE

(12)

a1wra1a1Tarf%5Gfi:'QEfii?rf3ruIrqIIafi?r%a°raa2Iqai619r%:

amv1?%fia1%r:Ta‘3rf?.*swI§amwamw1i%?fi§,31WfF[§”ffiHfiwf§13r1‘31$r z%fiT%Ia1§1,a'Iz%:ziavfI¥%fia?;aa‘¥1THifi1iHHTvi%H%I9?&%Hs1§a1aE5 a'af€ru%'GrmaT%a¥IatraHr%f%~u“-3fia1E=1FIH:Q$wf%Irm%f%-ma7ra1H

—wTwT,aaa—wTqTqa‘f%ru1Iaz°rGrmas1fizhfiaT%1EiH%,fir£%fiaj1a1za#

Wfi*wTfEIH$I#a%aa%?r3ifi#a?rf§1sTa?r,31fi:f%zfiHf%t¢diwaIqTaIIaT

aawnmfiwmrwagafifiwfimmfimfirfiwafiwmfim

aIT@1TI3aF11’s“I

awflaaéafifiagmafiwfifiwfiwmfiamfisfitagafi

%Ha1aw%H1Ei%I1¥f%§mTa?rerRwrI§a?4T%?wa°m4'fi61T%TR?fiw31=fi1E -sTr%1'a”f%7FI"aTz°fq'<'rfi'{arl*I

éfifiawafimfifififiinaammwafiwfiagwwafiww

gTI=9r§1111=T€ré?fi'afia1TTa°r%,n11?Q$fi‘q2r-f%I3iw&Hawf1‘s?rqT f%Ia=ra?rs;19arIHm1a?ramT=¥éT§3‘%I3fi1fi=rg1T=¥a1ffiI?fi1%%I1T

—f%?1?1=r—f%*s6?1:vrqa1°c'rw1r1?‘rI%‘t'9rarIaTa?»r1?.'?4T,a‘*§, ‘aT.‘afi?«rI‘-rrar

f%a11°r’I3a1*T31j?IEa?r%rnaTewa»vITmfifi‘§qam%m‘%?¢r¢€wI1Hr aFr1%uT%afiTafia'T%f€'::a3_¢raqa:mmI¥a4?5f%aRTa#amw3aw1w

q’Er%1€vI3rI*3IaI1%5aTIT§;zr<°r%nttT=3‘3FrI1?‘ra»"rst21T@r%I‘

(1)s‘T’.%fi?vrr=1'r2If%1a11°r-31=fiI‘:'FI3*I1=r—!g28

1

(13)

a?5¢f?WwTI¥wi3rI?rr2r1%Ia11°r9raga1Ea?r'ua11T'wmHTq?iHf'?':raT

%afiTs1Iqu11TfiHa+f%man1aBTfiVEfianT9r%f%11zaai¥?'au11#W:u"$fi.' qT%fiaafi21T%I3111?ra%'¥w!Saa°ra1aT%1'?t€3fia1Ea?rafi?aTg»3Qa°r .%f3—‘tfiaa=fia1?rH€TafiaprFrraa»?fiIsa%f%11:qamTmI¥a1?sfi%I11¥a?r 3H%:¥rI'%¥iwTI¥q€%I1H%ra$raa1aT%H1wa1traIf9IaIf’v‘5—§m?~raT$fi a13_a1za:%:m1¢z?=fiaTf%qIuaaa,an1a1a$%;HRImvaaa1H$fi6?1a$

%:sfi1;uT1=rFfi:fi‘-I—cr2%9raTI%'1zI

's¥.w1ar<ma%'#aQa'fi.'%?§aTfi$WaTqTaEré??§q3m?rqas

a3a$a11?111Tn1HTé‘sfiTs11az12I1Irarr@rra1Tw3fiTamTa1?wsrfir%1Tfi‘

sai?ra'eia'rvfieT%I‘

s1T€I1a1¥3a?r»"ra'a'1%%I1TsmaFrr%f?r:a3;'a1?afi'{%fiar<aa»?1T%, m1?3141¥q&nfiTaH¥'aIfa3fia1THafi‘{‘%GIa'ar<fia1aTaII?—'5ziaTHs?I uavR1m'z9ra€%fia?zTG1TmaT%f%sa1%?aI§1,a1?a?TIrfE=11a:aT§f%a?r a1:jwmHTa1*f€1$Uf%IfiHn31T%I%IraaT,afi~qaT,arf?1Eiv1HT#a3;'a1a$r ziai%ra?a%T9rwI=rf%taT%,qi§'sHa?r?gf%I¥§WFfiHTa?r21n1?r1%31w?r:

Irffilfifi €a‘a'w%I

‘s¥.€fi?mWafiI7r'9ra1gaa$TE;aw-werfiziaamfigqaafilgfir

(1)arg17=I1=:'mT g?.6f%?=I1T-arI=1=‘v.*s:$r9T1é1wvPrFrvzTr=i'r.*sI?=I»'r9T-é=:q'

qv1=11?41a:srf‘5h4Tafi‘<sr;[a1?-'g68

2

(14)

2a=rIarI?éH11aT,wIaHTefiqIa?ré?ra?ra1fia%?%I's1a13(PItz%f%9r

aa?rIWaIa$r3aHTn6?crHTs°fé?r%'i3‘1afi*f%wmvaIa?rI3Hfi2W=¥1%%I11T Efir WW (impact) é°r§@’-T%|

‘6?fi?§n1T'fi§f%fiqa:afiTaga13'rr%Ifi7qTa§snHH'arI#an

'ar%a11¢'%a?§'a1°r3fiTa'a'11?r§vf%r$T,31fi€m3a:qTa”rqwTatrs?1T%

awsrwTaa?r,31?[f?.'H§f%'r%m3$a%53Ifi2aw=¥6rrfi*a?rQ$f§mT%fi%I2

s7r%rITvna4°fEr?rqTefiziaaar<%r§"q=:€a’ra?r111TGITmTr§'f%ra

'fi:i'a§n1T'a»‘?2gf%I¥a1§1,a'Iz"rrfe?1E5a?rafivIT'%I

'nE1€a°r¢nf'?3ra1§1_a1?a$rgIar{a?I'2fafirmT%,3a=aifi%wa3$%1TqTa?r fi*s1wa'r§a1qfi3NT1°rai?fi%‘3fiTGra%f%3hfiTI§§HiT%1TwT1¥an?fi%,aa

%3HuTwT%f%I1:mfififi1BFfii%‘3fiTa1IzaTrEaagfi5Iira°r3?q$rEi?fi

%“f%I:arq%rIi1anT%%E3Fg,’f*=Ifiq1Hn$wEH%r$r¢J§F$aII%5arq€r%fiaT nB11HarmT%IIir£fiqi3n$ma?31Tarfi=5%?a1fi»Tq'a#an?aoTl%Ha1?fi

%=1Ta13rfi§$a»'rt1fira=ITé?i°r%I

(1)3fi1,a'I?:'a~—oiT §Ef%a1I-anariwmémfimrrézwm-r?na'

grawmfiwfiwafiiagma-$69

(2)31§?vrI?:'aTo1T fififi=I1I-aI1=IT<'sI$rsrI§'nv1°rav:Téa'sIEHr9T—5?'<a

§vI=rI?q$srf?nn3fi'<'a1=_1_‘q'I'q'-I570

(3)3?"§_1,'°1T3'EF1T gmrffififi-snfizwméwvfiamézsmm-fie

§vI=I1?cmsrf?nn3fi?sr;1'cI1E-I370

(15)

z==1=rIarI?3:%na°f,%TIa=1TafiqIa?ré9ra?ra1?ra7a°r%I ‘s11'&z=It€%f%&

fifiIWHfifi‘3fiHTH€ETH€T3?3f§fi1H#fi€3fiHW&T$}|3H3?fU‘Jfi‘f3?l11:f

mrsnnar (impact) é°r§@I%I

'fifia§n1?‘a?r§'f%I¥q$a1°r?a1§1,irIH'Ir%rE5q?a17gsnHH'arI%raaT 'aw111'%a%‘v;a1°r3fiTEFa'I1Fr§f?rafi,311€Iwm3H;q?a’rwv=rqefiT%

a1Tw1Ha?r,amjf%a3:fi’r%m3%5aE53?fi"<Kq=¥a'I?ra%qE5f%aT%fi%I2 3=rarI?vna1°fa?rqI1=q?F'fi=Ia'a7<?rr-gqu€a°ra?rraTG1THa»?IT%f%

'Gi=T7.'§n1T'a»°r§'f1?a‘I3fa1f;a1a"IIfi%11a:a%°rafiaT'%I

'WE133°TEFHf'9f31jfi’I?fi5f§GlT€331'Q°aFlTlT%,33?I:ffi?9F!33?WTWTfi

f%flw?rrE3aa?rarwfiai?fi%afiTaa&f%fiwaT§§afimmfian?fi%,aa

&a11wTuT%:f?a1zanfi1%IH1E»'?fi%'3fiTHm2Irv3aerg»EHir€fia?q$rs1Ffi

%fi€sIq9ré1$R%?f%Iva§RIfiqiFnE6qBHfiamrQ$aIfi5am=}%fia?

n3111IaRfiT%IQ¥fiq13n$aTa’ra11aIfi=5%?a11%Fq'a=T3nTa¢TfiHa7<?fi

%11T319rEޤ$$rtrra'aHT3?Fr%I

(l)31j'c|'Fq’fifi|'T gfififiw-armzsfiménvfifimézsmm-aw

?jTr'l7I'lFl$‘$|'Fr’l"5Tf3fi'{'31fi'¢l1'<«"-‘E69

(2)31§H'W5F{T 3T.af%?=r1T—arI¢RsI$TsT=314vFrEr21Ta??.'srfi?rsT-aha’

§v1=rI?¢=H:srf?1“3rrafiTa1g‘cu'r‘<'—lg70

(3)31§m'c.'amT §r.¢i%7=t1‘<—an=r7q*sr$rsTv§1:vPra*erré7:’smrsT-firta

gawmmsrfitwafwsifiw-g7O

3

(16)

¢??;,',a%'1‘éilta?r3HHRvna#t10fa:a%?Ha‘?afiTmTaa»7rr,aalfi:

f%‘B1$r31TuTafi%afia'a?$ra-&wa%wf%:mraaa?%,aE°rwTuTaH:f%an-H aHra1T2rrI%3fiTQaHnuTa?rf%:3lwaTafiz3r§rn°r%1TuTa?rarawrva%ra:r naT~fi=r%3?T%11trrfim11%r%vr2II?rq$a'a'aa7aTuTa'q'f®?raRaTI6?I ua1EHw1uTa€l3m?fiR"=F?*a91%r3lHa»?fi%sfiT3H241§ri%ra?rarf;%rfi.'1¥

a1HTg‘%6r%fislHafi1T%I€rffi=7r,a€TaTs'a1m%f%t€fifi3‘%fiw1uTmarR fis1firH'e.°f%3fi?QEfiaTwTa?rar+§="f%I%s{%shaTafia?r,§141°r%nwTa5l HTFg»'f%1$l%3lwfiTaT%:a§;1ma1a9ra$rl%I‘R1Té?a3,a1a$a‘#wl%Iana?r fira:cr%I

afir.Gr€r61IqT9?=I1Er1%a%Is°f%f%==I11°fq1"«g'f%fi'tai‘trari‘I '3‘|'l'{T‘fi'?T

f%a1wTa$ra11h1TqTsa1RIf%a11a?r#a§H1EwIarf€1$fi%fiTaT2}alfiT%I 314%Hra?ITw=ra'6?aWIT%l%a13firIa'a7rzfafiTs¥rq?fi'a=r:m1fi:¢%nr fr’ gar %I

aifivfi 51?.’ ‘Translation’ 31?? WET 5!? 'Trans' 313? 'Lation'51E:f 37 ?fl'IT :3‘ firfiifi 73'! 'Trans' Efir um? % '91?’ all? 'Lation' EFT SITSRI ‘:3 'H?Tr'|€I"fTranslation<'=Fr aT2f§'31T‘Q7=I?q1Tfi‘§?iI'?q1T§rGr1=‘rf‘3f7fi7qT’I

(The removal, transfer or conveyance from one place or condi­

tion to another)

'z;fi‘m.q.fieT‘#a§¢rza#¢fi‘%1Tf&Han?r§qaHmr%f%3Ffrr¢

alFr%nnT€Irf%?é”rH€3T%:f%‘11zarem1TqTI¥aa1H?fiIra,FEGr$rmaara$t

(17)

zgft‘2*arz'aT%I‘ =ra’ITn1?IaTsr?111Fr:aI2fa?rE1?Fr%3fiTffi?fi?:?r:s3?-Pr=¢?rI 'f?1:=.'T'a%?3?5¢f%%ntITfi‘3a$ra'a'f%%t1T@m€z°rGI1fiT%f%a1ga'rz 1¥'aI2f'a5rarf?rfi?59a1aaT%In1Rsm7rnfi?IErafi:Tf?ra€H%THH3mT aTf%1:f%'s?Efi'afi3‘n‘rw%fivr%‘,a:Ifi%:aa13r1?1$z,aBGr¥rmHaTa?ra%

a1?ra%i'??a»‘e°r%,3?4Efirfi?vFr29r%1°r@fiuTziai"erf?1aaTvI?1T%‘I

'arIé:=."i1‘f%eFrqEH%nwTa?rq1a=~r%rm=fiEHr,§141°r%1TwTa?rq13€r Hm1fifiwf?11?nqHa€ra§?IEa?a'r%I2a6°TaI2f,%Tra,93?fi%§aiaTw%°ra1fi

@¢tza:wafi7%§q%fiaHa?r¢f‘2*%mT#Ira'FI=Es*Gr1fiTé‘%s1wa?rar%I‘f?r tr<s%19r?r%°Taa»‘a?~rf€'IzT%I

'Q?=”€‘e.‘f*3‘EfiTm"9raI1aETfi$a?1a?rqTa13;a1E%aI‘%1¥aifi?ra%

a$rf3I3Ta?r%‘I33Ha$rg'&1¥s1§1,a1za?a?ra1v?fil;[1°ramfiT$r€q1fiw 3131,37:-srfin:TI¥aRHTaTf%q3fiTzTw?iaTa?ra1Ha¥3Ha$rI12I=¥g?I1°r%I

‘%g(H—%rF2Ha1=rz3(GPrf%?rn°riraT%IEfi3aTa°r3?1arrf@Ia1?r%I

a1§'a1a'a€Tsrf‘?trqT,q?'q1TawT3%sw¢I:rfiTé?r§'q3m¥2i*nfi-Raiwaw fi,auT3fiaaa5Tawt?cIHgtz%§fir=¥a31_a'IHa#¢i’<‘%1Tf&Hm%a?ra:Tf3rw afiT%fia1??a:n=?rf%mT9ra§1%I$qTf%‘1fi=fi%fi¢fiV1TuT|‘:’aH1§fi‘§%‘afi?

(1)sI'=flv1=I'I§{?«Wf%'«‘<.‘°rE='T.a'7I?fs11é‘-Ig73 (2)9'efiv1=I'1gL?—I$1%Ta‘?eT.an?«rs11Fc'-I372 (3)91z1v1=11§-r«.vf%7<‘reT.a7I?rs11é‘-I372

S

(18)

a?HE=‘Tafi1'%ns‘%‘,awHa%:¢R§'s=II¥a1?;a1EqTf%%r1TaR?rHn2Ig»T§aw

€nT%H1n7}3¢Feifirz?GrI?r%'f3‘H$Ta4hTm?u12fiaE“f3i’r‘tHHn3IfiT%I

1. a1?;a1‘<'%r1%11:6razn1TwTqa*aiH%mTa?rana921afiT%afi?s7r fifimwafifi a"f’v?tT-r?rr1’rI?=t7ri°r313f:ITa$%'fi‘-I1;rarf?17:I1If?r:

an?rfErcr%I

a1f1,a1z'a:£r§*fE.'a11aBTfi$a2IT%111=1a1fi2i*g?fiai?fi==ITf'?51zI

§rFI=1Tqa?3r%1111Ia1'g1_a1z'a?%?n?rfi'311FI=1Ta7rvI’rsr%116r

qeaT%,:3?¢sr%mr #a1gma'fi‘a1HT,3rga1?:$a?ra11=:=IT arc¥aIm:ra?n==rTF%qI

a131ja1E=3fsrw1ErarI:Ta¥f%11zf3‘11Is*IFfiaz°raI‘9ra4T%,a€rH1?fi

a4'g;?=rTa'«=r;m°rsrq:11“—Fr=:ITf%1zI

fiwa?r%1%Ta21T3"f%I?rGrman1°ra1§1,a1a$%‘?f?-‘t1zarf?4a11f%I

szga1?a»1?ran?Ia1ga1a$%:n=rfi‘u'a'a1HI%=fiaTf%qi'?fi

314EI5rsr1%"a:zaTsr211q?r::1?«rfi=I=rIa€I?23(%afi1'f%?fi21?r:¢mW

avian

§‘F|'?7=l?ffifiTT3?@'i§7T-3fiE'9f?331fi3T3?l§3§@'i§71'-311E3ffifi

¥rrrFIHTnTf%'f%:a7s1'g1§Iz'a?rHT2i15aH1?r19iaTs'1Im:a=rmfi1°r

%I

(19)

8. ar3rot1a'a:f311Tf%‘uTa5ra1§f11aaRfiT%,321f%uTa%Tf%‘siwaTafi,

$'r‘%117=rHT3-1°f<'=firrI'I?m‘<°r31fi¥f%nzaT‘9rfI?1?r%I

9. afi?=rI?.'=?I:fim1?1°fa?ra117:IE1fi$s11Ha?arg;EI1?:’oHfie1?ITi%‘r aTf%qI

s1I9$I?H1i°r¢F%%1TwTafi%¢f’<“qTsaf1¥FoI%ITIaR9r9::3¢€'rvr2fi.' aHmTG1Tmfi1T%f‘?t€aIga"IEf%t:£fiqa:%nwT1¥arf31vfifif%é?é1a$%7w1aT,

fi%11fi,a§wHT,a§$1f%fia#3Hwma?rf%f?IraaTaTa¥mw,fi?d1§H1°r

%nwTé:fi1a%E§R1am=fi%11uT1¥a?rR%raETaTaHT%,H1%Ié°rH1vra?:'amT

%?:a'?«I?a7rz?1=r141UrEI?‘rg?~I3TI9ra7rq$atWI%1°r%I

31'—g?=I'IT-.'=‘:7rfi5r?

a’r%1TuTafiafrqTe4?qa:§H'%%:f%IWa13?I,qEfi=3‘af?IfiFrf%%I11°fa?r, a¢wa?r%fif?r§a%1¥3wn%ra7rnaTHé?'313,?I?'a»BTa1aT%Ia'af&a1§fi1z

%na?RTa#f?rwffiHaRHTaieT§f%=?vravr1f%,ffis?%fif%éaw-f%‘s3?wwafi

§I%mTa#?gf%I¥I1a?r§'q3w3?gfi69a7R°fa#f3rtIf1'1'?raRHT,a1ga13%

2a“<Kcra»°r%111319r13i¥4B11F-fift‘-I?s.'3°r2=I%11Tl

I :refivI=r%a1T%IRrtI'<'

1.f%rffi?rarfr1?

2.1fif@$ar;1;=rIH

(20)

3.mafi=Frafi17=t1E

II.%rrn7fr=?Ha1T%IIT<r<

1.a1f%‘ffi1'a:f%t1m’fa7ra1§;2rra'(f-3‘1a:fi%?r1%‘qTE%,3H=‘ra‘”rs

<$)mnaW

(Ia) Fl1E"=FlT;;T=l‘l?

(1a)emrf?~I21°r,an1‘?."I

3.aTl%f§:arafi1Hr%?&a71%u'a°faa1:rwi%?r2aqI

(21)

"lgiam fififi ii #23? 1} 933;}

T§r'%) “W10?

(3) %TI7-TI§'q-5: (HT1%f§.W (

’ IE |m’§"F1)T‘3I'GI’q°r'

Wm’) *7

(W)WmfiW(mifiq _.

““°‘3Wa?=I1zew'a~a$=3r,

f:°'fi"—°T9Q?B°r ff .

3% E":”‘T"‘T3‘°‘fi'v‘f9=ui=r:fia°r)

(q)HRHaW(q§r%*3‘Ei,?W,qaarrfiHT)

(§) (fif%Hfiwq¥$r )

(a)?aTiFR—°T(fi'9:lBrzq'a-sf‘fi.’q-fia-5TQ7‘R«'Wa?,'a­ f3'?1T

mm-%)

(Gr)1%Wj?'T°T‘(F11%HiHT )

(§T)3m3f3‘§7=T|?|

1'3m:§fi"“iW(wFr§@m)

2.q‘{g‘;fi7.r3‘.gaW

(22)

%1Tu1%la=3aTf’v‘1$aIe=I11=ra»'rHBc—q'

a‘a'a”r€n=°rHn3If%111Tf%a1Twa:sr2fI¥%1TuT,%rmT,f%1%I1fi,a331a¥, s13,'$1f%IIIH:%f§r¢wa?rQ$f%tf3rrEQa*H3r?finTsw%'f%m$r{1v§I3%W 2BfiT%a?firaTa?a71a1F?%:nHa?rmTf%raT§gfE.*Ia111?arrWa‘a'mH?r%f%:

3flW3?f3?THE[Q1'¥3‘%TfiG'f3TFfi'3fi%33fi%33l'%fiWVW31fiW3-Ffi'§'fi°f a‘a'%a°ra?RarG‘r1¥aa?fia:s‘Tf%aafiraT§f€?1fifi€'%1TwrF&?11?r'a:r%fi

3-rr1gf?1—~H¥rI41vr=3r'n%'a'guT2r$Ir?1?2‘°r'%I

f%IaWa?'f%f§rrzsrm'%'If3fi‘rtzaWa?rnaW=«'%f%?éhfia1§%,a#a

%nTs'HQa‘%1&w3rsmm¥m1$ra1HI31T‘§f%fi'wTuTi%s11H'q?fi%IT£ar¥

a?a‘a'%aTwTfiH1a41Qa‘nE:=rarsaa7rfiuT¢ra1=rfi1H»TvIaT%3fiT%1TwT$r zia1?%:mfiaI1‘?5aTfi11iivI€=H¢$ITwaTmH9rfi%fiafi3‘3rNf%rHTa°f

%1%IrE21a1“<%l7sI?='37a-'aIf%5fi'H'a'a.'Q$§‘sITf?fiwr?%I

%nuTa?r9;1nnfiz9(3?ar£,31fi:a1'afi?f%Ian11a$%f€‘—rH=‘u%#°rqB?g'E

%‘,aWHVfitm?3'aT$r,wTwri%aWfizfiiH?Er%Ia'e§?f:a€H%9rfi‘%fi€I¥

flfi3‘f%fi$HE°fsTd?i%I~‘wTwTf%?IW®'3’HTf%?IFr%f3‘t11a7rnai1T,3nafiw a?&$aIf%5GrI9r-aFIvrr9raRfiT%IafiI°fa?ra‘E:Tafia?rrrns1%ra112I,s%‘

uTaTf?na1%rHnw,nTs'§,'f%1fia%wTwTwns19ra?ra?rf§13TaR??¥rnwa§?

%11ma:raIsaa:ran?ramIa11aa1¥wTwTf%s11wa?ra‘T3wuiwf%trwraTt3T

%I

(23)

HTa'IBT,%nwTf‘?t?I1H$rIrm1wIamaT22;?vrwaIIa1aa1¢313%6fi‘f5rcaaT

qwwaxwafimfiafiafil

uTwTf%Ist1wwmT%:§i%1B11wT%Tf%‘&I2#f?1a19rarr9a1H%i%11a1¥w1wT

afi¥hnaWrsfi,f%*siwaTafi,aqt;'%IaTqI%a1fi$§@afiwz3(f%ta1Tf%»‘¢rfiT

'<'sT%I

%1TwTa?r213naH13fi,f%u‘shaTa”f,a9'c3'f%fiq?f%fi1Tan9ra?ra1H23ré?

aTs'PI'Ee}naTf%mwTi‘%a1Wa7rmnuHfimHTnzF=I*1Uf%IwTwT%:EI1°«r, ma',aI2f,"6w,a1aw,f%11?Tan‘l%‘aawaaWs$r3aTq?ffi1a1T2H%aRa?z?r

§'qmuTf%ts11=r9r%nwT%i%$I1T%i%t1:afia7m1f@i$r1%QafiTawm=fi fiHaaTwTwT%f%Ifi1$ra#aTI¥arqa°rf%tfiruz%;fh%FraaTa%?,i%1Ha€rqa:

g¢f’<*vrrw%'a1-g;a1?:'Is1¢cr<arn‘rawf%na1t23raafarHrI

%1TqTf%?I1warrsrI?ra?rf%rf%%r3n'aTa1T%?nfiIaIqa'w1°r&Hi'd%II6T%

3fiTs1II#d%I?rsr1Ha?r9fi'3aWn1aT=3fwTwT%?s;a’Qa'H'gI%IHu'ai1Ta$r a»'rmrIa'aTf%Frf%raT%I

=I*a'a1q$f%fia'I?a%2r%f%t:f%r<1°rsfiHnfirqa‘2W§f%r€l:aIsua?f%

f%nzs1TuT29ra61aaTafiaTz1aa?fi%'afi?a%HE1uaTGI’r%am:ra1T%rItsnuT

7=b'T3?lTfi7=l?3TE?T€FT§T%|

a1§f%fifiIr%:a3affmmfiamfi*f%fiw€waiw1%rmaT1€T%aEm%:

f%fifiwTwI12r3:fiaVffi,wTm73a1fi$aaT$Tnai1Ta?z%z?aT§7-f%f%rfiwTafi ll

(24)

afiE5gf?“24fi{1a3fiaTHwfi%lnE'§;'i%aT$?,wl%fiHaafim?%f%f313r$r-fr fia'ri%q%ar<1?rH112r%1Tq1%sITf3ta?FraT$ré°rHE11Tf%I?JTU1TzBT%I

f?¥»?~IB1Fr%nwT€1‘z1aa',3H'%:smn?q?f%ra'%%fi'I3rsfim{'f%I$f?fira?

Wq%,3?raafi€f?111fw%¥di€%%1Tm%aTf?1%5?gf§afiwa6r%fi61vI?6T%afiT aa1#su1avIama€%f%I»‘%1TwTa%éaTffi$uwfira?rf€'wTI¥a‘?3fi?Fr€wi1T 3??BT%If%£fi%fiarf¥fi5I?f%'f@5ra7réWaTf%I'@1aE3'@fi?£,a14fiWFrfi«$

1%«3iwaTs1°f€fia1'%1¥aa1'%a?ra°rqa1°crf%I$fit?rsT3a°r%'sm:r%fr

%1TqTf%3I1?r2i‘,f%31wH:311a%snIaT'f%rf&f%a1=r'z9(f%sTw21ii%I%I

m1T2'?I%?a33r1¥%1TqTf%I311=r%:nwq'€5a1*%1¥f%‘siU2aq#gv€6afi#

a$ranasaafirr9fi*anfiHTa°fn€1IH$1fiT,a%:1fi'€Iq1z*<aq2#Ha%a€r,9Hi$

arf%5u‘a‘GrmaT%f%I:wTwTf%a1H$rm1%HI#,f€4t%HTf%fiIfiHTs°f,af%t7 fi4fim,mz$anfi'f%u'HTa¥2%f%rmwT2fiiHaB1fiT%l§HfiEiUfiamnfiai=‘r

€fiawIw3°rHTf‘E.'HI=¥,mzaW3f,f@I=‘lwTI¥Hra1TwIgaFIIrFrarFr'5$r zi1§~?rfi‘<s3a1af?vrrcr3fi?a161VrWf??IT€fiaTl%5ansmfi-qnT<1’rq?

ari"%If%?ra1af?~rrqEWs'q?1EHE°faR?iT,af?q»"31m'I$aTeIar~Grr%I

s1¢qa:rt%11uTf%t$r1wé:9'aivrHTqTi%'3Ww§fE:a’rews'R-r=;1fi¥%',a1a

€WWE'3"§fi534TGTf3E11W%3fiiTH1'1'¥i?‘=fHTCE§'§Efi‘9f?3TfiVfi91°f

%rrq13'aTfifi5eia'1?a"a1§cI1?'$rsfi=ITnsTq'aa°f§‘?

s11a7r9fi€rqa‘PItz3?1Tra'sTmf%‘afi1_irIz1¥a°rwTwTafiq?f%fiI1?

(25)

B1HT%Iai?ravnaa2r—a°fa7é°rGI1=?a1?fiaT%4TwTa1°fa?rf%31waTafia7T qBi1fiHr<,3%Ta“fa?aH1¥afifiHfifi11°fa$rqTmTq$g'a%%1?IaEa1HT éT31§a1?6Hrg@zI3'%9Ir?BfiT%I3H'«*?qE'PTts:f%I‘f%fi%i?I?'aE;a1E'fi m2fa?®‘wmaH1%r%€1%‘11I,3T§fi1H$%¥f%I1Iw€wf%a1If%i%aFa'a171T

mmafafiémfimfifiwmafafiaisfimaqaammnmwfilasaam

arm1wa?rafH€T%,a21fi%§,a?IfiW¢fit}&2rfis°rH's°faf%‘q»"aIf?iifi

gf§afiW23r%fis1TqTf%fiI1TanHTq@.*aT%I?g'a'%wE:T=?ffi'fiIITGrrIra?

%rmTe“raTf'?1$a2u¥a?r:fi%a'q?éTa1§arraar17?rf?%fi2%aT%,a‘i$Uefin$IT

§13(f%afi1?Fr,a11firr1TafiTa12$%?aaT%Ha1TerI1rqTafi1=fi,3qfi:1HafiT meH:Ia”T,sfiHT2fia°rIraa%mf%313,a1E3?aa¥m%rwT¢IéaTf?Ia:a?cfi2?

gvrvmafirarfizmgffita?-r%amiT%nw3$mmafiéaT1%a:f%‘s?wfiT§am?r ar=Ffi2%?fi%la%'aTH€r€'fi<Qfi?éTWfi‘a1?é?siafiHarIfia1?fi%nNTafi

&:af;'ara%#<3f=¥$f%?r§§W.6$w3Taafifi%',€Ififif31$rf3‘I$r¢fianT

I¥arI=%a1?fi%nwTaT%?éfiaI§?I?aWfieT§Err{a?I?f%Iffir<%fi,w1maT%:

%a1f?maa¥a#,3Ha?rf%9iwaTaTa#a1fi9r=¥$f%r11afia1aT,aH%H11aB'Tii$

uuiwq?f%‘sW§f%afiwua:TaTaTq$a13;aTaa:Ha13fia'zT%ra=raamT%I sfiuT2fiaM'a'a%%Wf%3m?rHqmHrf%IT%§F$3I3,H13E6a?r%fimfiI?H’a‘T, erfis qanawurreisrrfi-s2n‘?%FS:Inr1fi‘s1”rafia:a‘r?fi%ITf%m

(26)

mmémfiwgféfiaafifiafixfiwfi

ang$arf’r‘6a1Traifi%mTI¥afi1"§§‘§a1Ha?r§a%arFr‘sa1Tr,ar&mnwT I¥3?rR%r$rHm?¢é1H1wI?afi:3131,a'I?a?sTa1fiT%IqiTg'3Hfi="raITm afiTffi‘aEHéTf%'a§HTE'%:f%m3fivna?aIfi=5wTa%a?fiH1E?fi%If3refi

%fi37f%r$rI1afi?rIa7I?,a1T3?f%aa"raffi1E%fi$THamT%,6‘rf%tFr1Zr@

aaamfififiwrqfimwafigffifiagaméafitafimwéfi

mTaTvfi9rnfi*a??q?'a131,arIz'%f%i1za1arf%vqTa%3na3aaw?1TqT§f%

:<:1?~PrI

=§T,s119asrIa131,a1Ear<?rafiIsi?rHmr,=g?r§I%r%:a1wm?I3?r

§f?r$r,aa%IfiH1a7r?%:a11’v‘fia2#ahia'H%,a?Hiii%Ia?r%fisrga1a$

er»-‘rafif%?rr=r<v1Tr4e'cIT%I anfi?g%1TwT,‘=§f%rafi?za=r1a»‘IT%:an1"¥‘m%:

nTam1z¥fi?dT§I%ra7r,f%t?afia111vrq?GI°rm416rqefiT%,a11m11aa?hfi

§a'fiwTwT3fi?gH%fim1E5R%7a4fiafi%nT%nw23r§?I'lan1Gr1¥aga1aa:

a?raa11=1Tqe*z?5T%IaieTafia’ra'a'a4?5z?G11aT%f%€§f%r(aB?§f%r

@nfiaH'aIma?s'aTmw'#%)E“ra1HT=¥aFvfir:2‘a'a1?fi%IaI?q?fa‘s'f%:

§f%ra#®?aar<wTwT,ra?Ifi4$aIf%fir,Hn1vfEfiHT'ag?I?'%H1aVfI¥f¥I$r IB?r%I323rafi'€%1°r1=nz%?1TGrI'cra°rII‘fa?rI?JTGITz1EIfiIT%:—

1.zaiH*s1TqT+3:f%11v:r<$rarf%fir+zgg-rg:l%r(ar&r-m?a'a1Ts12r) ->

awffitfi ->sr*s11a->zafi?r%1TrsIT%n11‘sI1ffa5r2mGr

(27)

2.a&mnqT+grf%1a:rTa5raIfi=hTcr+sIar<a?s.'a1Tm2r—>$rwf%Hm11Er

—>a'&2nrrqT%11ffi2fi$Tz11mr

ua”Ta1?ra'a'%f%wTuT%:mv3vf%1wrt%arl%»Tq'afiT§:I%r$raé?

H1F:l'ITE:l?rW?F:=‘°rHHIu1q'<'dHcbI 31H< ={sdI§'|3vF_,,F=l1'<.'$3‘?tI1'<~’I3r1‘TrFf

%nwTai?34v9ra11’r1»Tq'avrqaiW,ar{9rau°rsr1v11z°rHéT%a?3H$ra1q9r Hn1vrq?a21Tm11aq:=.'m#r§?sn1r¢sH3fi?§f?1?rar<€5éfiaTa?rmTIraT

fifi: "3TFl"fi'T m1%ce4«=m< 'Eapf31-galldch EWv1ldl %I'I411’<’2IEra1?1'HTs‘°rQa"

1?1Tm?H‘a‘T%IIi'HT311fiwa1nfia1a’fa?rqB?TaErGrmahTfiTf%"If%:

'aI§?rE'f%taW,f?IW6fi%mwm?IQ$‘amT‘%fi%lm’raT2fisfi'arq9r

srma#a¥a9ra?raWvrr'%¢rrfi'I%W,awifi‘%t€aB°Ta3§12%Ha#anfiiwTfEla:

fi'F§rEfiT3fiflE¥fi3?f3?3Tq9rEl'f%wTq'i33fi'§TT€?Tq€fiT§'3fiTflB'3fi'

%2fi$ITa7<a‘1‘f%srq9raITqfia°Tu9raHraHIIf3HHTarI111?r%fiHE°f%Iarr¢

u¥fi6h5Tm9rwmE5ia?a9ra?rf%1a?fiafiafi‘f§‘Iwa?rfiIE,a%6a1'a'z#a1”v H€TqT§‘TI31§;a1aaa"a?rfi541%’rf%7d?a12fiTa#%@H~T,a‘a°fa12fiTaH19ra#

aIIHf’~?ta%mafiTfir@fig?Ta»°ré1aa~T,a%°r?gRTi1Ti§9r=¥mHa?f$a?rG??fi

%fi‘1m¥11aa1afi?afiT116r7g'ar€t:I;0fiafiafi$a1fiHz?e'é1a%ra%swGwfi?

fiE“faT<Hafi}IaHa?ramfir,3H€rUfi%:a1=aafi-ITa7I1°f%m?IqT@=fiaTf'%1z,

3°TI'a§?I?'a#q$f%fiTtzf%uT%:2awfi2dfi§f%rf?ma1?fiaTf%qIa3a?

aa‘uTza‘13»?raw%f3»‘m1%1%n1F(Hv{?1?nfi:m%W)%a§;?raa?r§mTI¥

zfiH1?na:(awq1H:)mf%'fiIafis1§2rraarfi1$3rmW%'I§Hfi?r$1Twa'a°r3?

(28)

aasm%fisqamma:m1%ErfifirwI$n%a1%rfi=r$rafi7§n€?q'H'a°f2Bm

afiT'ar2f‘a?rnaTI3HT1¥§a'f%ra¥a7n9ra?r%fia8°Tafi“«§anawamTH%!T%I

ua'f%ma1§;H9r%,a?fifi:,a1ga1?mW%(sfia?fiw)s1§aTaaHT9I$THTsw

aa19rafim3rq$a?rf?IvT%(f%I?s1I)anfi‘I‘§rf%Fr$fiHnfia?r?raa3%fi:

'a1ga"ra'a?r$%fr%fiq$a1Tq3?ranIfWé°fIrrHaTHTaTf%1zIa11a?rm?i?rr 'q$%1TwT1¥aafif%%IT2¥a#aa11i31Erm1=rqa'H3vfarf‘¥IaII%5a"RT§1afi mwT1¥s?rR?r%na1Ha?r§F%z¥%afiTs'H¢fi§'9?I=3Efi321a»"r=1ariaFr f3?qTa1HTaTf%1zIa:Hfi$wIfis'a?H%T3;?a1aTaTHa»?rrf%'a§;a1E'9rf%9J a»“rq$$?F¢‘aT%I am€1?r,:I?«fl$a313rI?r'a1I?vI°rsI111%'r21a?r%‘,321"a6r 'a1‘;,ra'ra'@(sIar&TaTq1°ra¢2'F=i%IzBfiTa’r'§‘a‘°rI

31§1§rIz'%?21aVf=¥a11fiaIq$3mra1fiu‘a'%fi%f%5'9'ai1Ta$TmaT'a?r

gfifiarfiafiammfiwfifimmfifiwfifimmfiagafimmfim

srm1?rs?G11aT%,aa1%s1T1a1Ta2i*f%I$f%1awTwTz9raafita:f€1?r%11wT:¥

aga'I?$?HT2fi€T*gFfiI=?f%I31WrWTwH€%fi'€f%$f?=Ifia14sfiGrI=¥a1Ffi

an3fiaTfia1?fiuTwT3fifia1§1,ErIE%:zia3f1¥=fis'“fH3§f%t31warN1%H%‘T 2B?Prll1°f?r:z1Ta‘°rs1E=rfF=I?-I=‘n* q?sfia1ga1a$aE°Tg»T:*ar<Ha7IT%I 5lfiI‘FT3F%FfiVfiH,fi$f'3lfiWTW#,3Tfi$[:?!fiWW1¥N3fiT?$?fiHflW

(1)e‘T’. («g-47)

(29)

a13,a1a$%?Wnf1¥a1@%fi$r9?r1€fi°r%If%a7f?1fi%111:TfiffiIa?fi%fia1?¥

aa13‘n3‘%,3?Ha%€rarf%ta»"fiafiwTuTI¥3a1IHTa:rw?ra7f%?rGfiTé‘IaT.

qH.s‘.f%r9uFm4v1TGfifi“§Ha1fifiEi"&—a@a?fHT3fiT3m¥%41‘?a??3'afi%

nTs*m29ra:?fi$I9ra?ra?rf§I*éTa?r%I‘

a‘a‘a?HTs°r%'ffi?'m3—q3W,ma-f%*séww,%1TwTa?w,a111'aiv1?r,I1?ffi

§fiHT—31HirIEsr%aT5t?3?rq??4'aiwm°f1i*1;Tu|17%HmIa131,a1a$au'T am2IT3fiarrIrmHTmHTq3fiT%sfiTara‘am21Ta’fa»*rHnTm?ra€§a%fi H%‘TmaTI€rfifi3”5f‘1“5HI31§H1H$a?razWHaaTH?a°fmH6??fiaTf%1:Ia’a’

a°r'arga'rq"fi1%éaHTaTz=°raTHwfi%I

firefié

34§a"IE%?2a?€wa?nf%f§1$rwTqTf%IaT<$fir%3cRFraE&»%TaT Hafirr%‘f%l€a§m?a?rf%f%$r¢f'NTwT§SH€|?f%I%BTH39f%If%‘Hq3FgaTa?r aTq:9a?mTe1F19ra?ra$rf@rwa%T?%°r§lwTwTé?3fiTf?1%fi3TEmW%¢fi‘qT’é 1¥aia9rq?a1§a1a$a$rf%véaHT3fia:ramn?1ffiaHT%sfiTwTwT%:§aTf?r$

aa¥€rs131,a1a$raT24°raTafia?r?%,aTs'%#°rm?1*we°r=i1fiT%IwTwT€l:

3aTf%$aaT%:wi%rf%*siv9Iméar<a§a1?f?t:aTGrmaH?I1¥T€Ea€m»?r 3TaTq1w,F‘rf%‘Fru3H1fia:refH?§fa=1ifi:snuT%:aTsrTf?1$q&Ta7r1%$m 9ai$%nuTff,9fi1H:z4aVf=¥sifiT%afRa1Tu1131aac7=rQ$z1ir9«:arrav;z'

(l)e'"r %fi?rI=rr2rf°c‘I?=I1‘<°r-a1"g;?=rraf%?I1=r(\'g-39)

17

(30)

%fiqHr<aqaTa:raB?f?ra1fianrrar%IHwmTsIrHuTH:€TH6”T31'ga1?$}Hwr a=r1%rfiiHaw$2.'°rHa7rr%I

(31)

fér-ifixaratrltr

m@amafi

(32)

waf?1‘f%?éhfi¢a§z#f%mfiI?r6rR~fiaIraTsra?r,a?6Ir23,WH%,2af?raTa' Ha#r§,fEF£%fi1%tf§rlzéEVf1¥ea‘f%$rgfi§1%‘F§rrz3I?f€rf?1$HfiT%l 3s1Tf?m€§'fi%€r%zrf5r‘a13{rfeFfi'aaa1aI¥qfiaFf¢raT3fi1?aaFvr'%”' a‘T

%4wr§IaTf?t$g&#a€'%nnTa?raEa:§1,fiW3$I3‘%f3rmfi3fi1?wafiT

a1Ha:aTau°r§f%zhafiaaf%?q'21fiT%I2sWHrnfiaHIre.'%fi:wTqTf%Ia1W

%éz%fI¥3Harm1fi$?6waaf?rFfi?f%'aa#r,PwI1%zw§HsfiTf%~r1amI»%r

%,mT?f3'1142sTafis‘aI?fHa?I3aT:€eTm19r2?aTm:fifh?9rz%f9rm#arm°r 3rIa1vrIahfi6?,u1§Harsa1?I1¥vfiaT2fieaf3ra5ra3,'a1H€521aVfI$f%1aT Grr1€T%'afiT3??r%im$2a1?rI¥a?9ra1F‘r¢Fia?faTa?naH1i2#a?a'HmaTaT

a?rf%‘s6?f?sIFraR9ra7rsI?11?=r1‘?IraTGITTe.'T%I

safi'a”f3€1g@!1?r:a°r%‘1a"firE1'ffi?1'f3!?QTFQ§I

1.1-?=I’<‘

2.E'iT:Ff

(1)sTT.%fi?-rI=rr2rf%a1‘-fi—%n1:Tf'3r:rI=r—tg241

(2)3? %fi3r|=rr2If?1a1'fr-%1TqTFtsI17r-tg241

19

(33)

fi?§31TaT1Tq?,&7%§'F%?1Tfi57+€|WiH,3v%3Ea”ra1=%EE§?Ha#r%,d1?3,'

aI§a1a'%z#aVfff2h3z',3W%?a'aa?rnB?aHé°fT1a?rIa1a?s1IqTf%1a1?fi

fiafiwfiafimavaamvfiuvfiniqfifiipfmimlméaivwafimam

31Im#W1¥a:W$r%f%'2aTaE.'2Hf9r%‘f?v‘114%3%Jr<w1¥6aTa1aTawf?r&

§af%‘aT2#f?mf~rGrfifi%afi?aiGFrEre.'ta1?r%‘F3ra%3%anw=¥aHT3rmTa TfiH2?f?t$FrHE°fma°rI'qa?R1a?fia*a‘3fiaEHT117Ifi%f‘?t?2aTGI€TIafi8r

*<aqfi‘sfi1‘?Hai?r§a€°Ta1awzafia?ra€1ufiTI3(3%afifi'1%r?EGrr&%‘I

sa‘f%1fi%:3firITwI¥afitE5aa-31%I?ra1aIIHa?Iw3rIFT§,f?—IHq?f%%I1T

mmafiswaaatqtsrwsaasrapffiwml

saf?rQfi‘61E1,a1?%:¢I%qT9a‘I¥f%a1?an%ra111IaTs'GrmHTaR?fi%f3:

'afir'%nmaHraT%rr<%3fiTaga'|z$raTerR%'mm'IsHaT6ea'f?r­

a§'a1?%7éia'nT—%éTa€r¥'E«*HErrREIT%I€rf?fi—aTR5%7afia'3fiIRW1¥a1

fl$mT2's'Ffi§',3Hf?I'sIaTafia1§;a1E=¥arI9ra¥1%I1z%fi31§a1za:a?r

i=af’?‘rf'3$I1=rfiH€1?JfiT1fi'rFPrq:3.'1fiI

(l)sT.%fi?—rI=rr2If%17:r11‘T—*muTf%t?rr7r-!g247

20

(34)

aiammafiaafirqéaaasnmafisafir

az1fEr9Hi$%4TwTfiH1"f?'ra:rar!rrITW‘a'a'%‘ffi7{%fis1§a"rz€fi9141Tfi‘

a1aWqTa?raa13ra:r,aa2rwTqTfiE1'f%rfia1taTaf€:$n'afir2%1fiT%'aafifi*

ar&mnwTa?r2a1%,aifi%n1aTa?r%Hf>:%3n%rITW?€rf%Ffifia?rGI1f?r%, fi19mH:f%11?ifiTwQa*31'g?3'@H%11EVf1¥IaifiWwTfi%afiaTa?r,aammT fif%1121?rIwaTa11fi1a=rar<9r?6qHa*r?[,sHaTaT%nwT31°f%?ama?raiaT

¢fiaf%ffiar<an1f?[ara2I%nuTasTa1?r%nwTa¥1aiH%1TuTa?raammT%:2aq 1¥¢fia1%‘Ha:2%r%7q3a1?[,g=EsHffi11T$rf%1121fi1waTarg@'@?f%aT@rI7?

qTa'a'a1Frafi'<'%=PrzIi1z3°rG1Tq11°rI

sa1ew€sf%tqai?r%1TqT3113:vfi%s'Court'sra?ai‘€fIaa2r%1TuTf%T<°r fi§Hfi?rWf?Ifi1aHs?Ia?Ta'fif%u»“aTa1aT%f%:'fié'IafiFra?a%nwTf%T<°r fi*‘$f%HT's1?n.'fi,<=r&znIrwTa11)v1°r13ff%naTGrmT%‘Kavita'.zmz%f%:

mmdaVfI¥a1m1TwTai13$fiqTawr%,afi?fi?fiwI¥aim11wTf%Efiq?I

a1=;a'la'=9in'g?5%ai?I'a’r'%sra7I=<'

31ffiTE13°9'g?5Efi'f3W°f3?3ifi1ffifi3fiVWqTQii'fi&ZlVWGTfi$f3?E!1‘7lWT

a5rmfiarfifi%‘f3‘W¥an1H?rrEqa‘aHmHfiTI:T6i?fi%‘I3?T?zf%fi*safi1a¥

(35)

aiammfisafirqfiaaammafieaffit

ae1f&srH3$%1TIITa?r2a'f3r$ramHTrm?cr%f%t3I3fra135,a1a'3:u2#Wff aiHw1uTa%a¢1?ra:r,a&mmTa%safir2#a?3rsrf%:a:%'a'a%:?fiT%aafff%v:

a&mmTa?rsaf?r,a1Hw1HTa?reaf?r€t¥a1Tm?q?EFTf?rfi§fia?ra1‘f%r%‘, f%I3fiH:f%-ITfiaTwQH'a3fi"@?éH1afifI¥IaiaWwTa?raafimTa7r,aamnuT 1¥fi1~21a?waTa13'?%IawawI9ra¥¢sa1?[,s=raiHT%nwTafi€I€$naa°rafi@.'T

¢Rafi€fia»?aIa1?[arawTwTa?ra1H%ntITafiTaia31TqTaftaramnwT%:2Eq 1¥¢fia1‘%Yfi3R9r%?q3fi1?[,gH7&rf?mT$rf%I12ia1wmma,€I'@Hf%!?mm€r crI=re'a1?rafiTsfiPit$:a°rEITq1fiI

aa1?3Tw%:fiI"qai?r%11uTa413?vfi€H'Coun'sfi:'a$r€fIaa2I%11uTf%a°r I¥3Wfi!i%'1fi1afi3FfiTa'¢}f%rraTa1fiT%f%I7'afié'laf%fia?H%nwT1%'E‘?

%9('arf3'aT's1Ea»°r,are2n1TwTai'*3Tri°r19f1%r=aTG11?1T%'Kavitai.z1It2€%‘fi7 mm21EVf13iaim1TaTs113Trfiq?a?f%,3fiTf%Ffi?I=3faiH%nuTf%Tq‘Tq?I

31=;H1'c.'v¥u2;'r'5%aF«17fi'€5=fi6I?

3fifiwfiuv§seafi'q¥%a1fi1ffiefmmmqa‘aa2nnmafia=rsafiaT

a?ra1fi3rfifi%f%H1¥HmH?rrvI7qH's1wIFmT§e?Ffi§Is1w§fi%z?aa1?1'a¥

(36)

%:%rRsF:HrIs°t?r%I l.HnW%a1°«I?fi

2.<-«nrwTw1'rreafiIFT’

3.f*113r%I=IfiII”T

4.W1If‘¥I3r2af‘?Pfi

anwreafirm

N‘)

m117r%aF111°f€r:aia1fHaiHQa'a&m1TuT#,ni%a3Tw?Hn17rErf?1'a°f a?ra1fi3n?fii?,@r1?3i1):—fiG,B,M3fiTf%Ts‘rT[,a[,I{IsF%afiIaT%91fi1T fi,31§p=r1E%H4aVfI¥afi"s°$f%7r%HTa“fz’fFfi%3fiTamfi3fi1§a1TIirsfi

sa‘i?nz°f$rsI1fi1Ta1—g;T=I1aT=Ha'»“<¥ra1s?r'%»‘I

awwnanweafifif

37raa‘f?Ia’fa‘fia€fiIi14°rea"f?I11°Tan?fi%‘Gfigfi:*a1HT=¥Hn1?ra1?fi§

3fi'{ga—e§a1fi°fI3fanTIrr¢rIG?Ir'ar'3fiT'a6'safi?fr.

fi3I%Hfim°

3fi1TUra?4Ta1aw€m?1'<q?fiI$rea‘f%'a*rs=rsaf?i7fi%€3iFI1faan??r

§fIG‘ni"?u.vrIH'%z1a"s$I¥:I'«g?fiafi'srIfi?R—fi'§f'sa‘f?rIIITs’a2§7r:'H'%frHB°f

(37)

%aflT'Gr'%fiH?EfIa1H:sH$rfirQ'mTwaTsrf%1fi1afiarG1T1gf?‘eR~rHTs?

a1aT%IE3fiFrn1‘&a?TqT'InGt1?r'%é‘??avI¥6HI1Ia311a‘a?%fiaTd°r$is‘

a1?r3¢fe‘2wr?re?f31FfiI31§;a1aa=a?rz;fi1§sIE»‘TIIE°T$I1Tarfifi%I

qazwfifirsafivfi

Q$awfi1$re2rffia°ffinfiaHq%5§a'%fiaa‘uTaawsa'f?IIITfi%IGH 'q'37RrHq?'q:'aT'w'$ruaiWIfird?%afia¥z#aiaI§a1aEH$rzia‘H2BaT

%3fiTah°rH'rEru1:fia1?fa‘a‘a?a€Q¥fisafi'aT%9'aiW!3(a%rHa»?IT%I

31E17=I13%sm'\r1za‘%afit

a?Jf€r31?fiI?%a§?rHI‘£9arRe¥afi?r§,f?rr<%fi%af?11‘?firt:r%

wfigvwfiafimfimmfiwfiawmfiwwwfigmfizflwmt

anfiawaarlfifil

1.firffiFra1§?=I1T:'

2.Ifi1%$aQaT<.' 3.mrfi=fiarg;a17:'

E-rfafiar-F12

f%rf%Ha1gErfi'%z1a3ffisafi'rf%?rmfi2#a?s'am2ITafiaHranHR

23

(38)

gv§arH:qTfi‘3nf€WsTa%,s1wa1fiafi§14—%mE.'T1¥a%TGrIIra?a1§a1a'I¥

eaf?1a1311Ha?rIFmaa+fiman$ta1aTa%H%,qTf”mTfEr$mE.'1aFfi$raia'I Wfi‘WTf%I?591a'¥%¥a'g?W%7éaVf1¥f?«I1fiH1W,§f?1fi"@?a%a13Tf?rfi?5 sr§ta?1T1T:»'?Fr%',aWfirea"f?rf%Ia1=rz9(zfie1T$m*2I2B?1T%‘I

f?-t1fiH?Wa?r3na3aafiTf?I'mfi1fi:firf<irf?raTfi3rf?«a1?fH:6TGrEfi%I

1. GFa«'?ni3‘firf%H%1TwTf%efi§ai°ri%I‘f?1‘a?ra1111fiv*1$,21vrm‘fif?m a“2n%1Tffi$$ITU1°f23r3rcFITr1°r%I

2. aa'qaH4TwT§111°r%n1:Tfi‘91g?5aIFr‘t»?I1=:I26an1aT1v41Ha1?=t$

s1a"fa?‘ram=Prf%1fi‘fi‘f%t1a?|°r%I

3. aHi“?R=fi‘%1Tt:T$Tafi‘s‘a€WrfiI’f-$raI’ff'3t?£1°ra1='I%1TaTafi

sm=FrFo‘ff€rfi‘1%fiaTC—rrqI

4. Gfi=rf%I?<4°r%IrwTfifa1nI%nwT%a1TnHs1a'Tawrfi1%Ta1111?r91Efi as’rfi—‘naTtrrrqI”'

(1)3rgfiI1‘:'fi‘4aTFfQa‘SI?fi1T-§fi.GFrTr‘rtfi?rT2I=r3_' 40

(39)

aIarf?~I12iaWTePJT%-3?TaTq3&Irr?ré‘li‘?‘vI12i?rI0T$rrrrfi~fi:r§‘

ai?r%1TqTa~‘?a?f71°rI¥9'{;?5aIan°f%?a111HaIe1Taa2I%mTI¥Hai9rwT awvH1Isa¢fiuaIa1T,f?Iara%a=fiIraran°faTg:6f%‘9TwamHmTtrRw?

fifirwaafimmhmmlaifiwmfiaéfimnafifiwfiafififlat

=ra°ra"r,31=r?R€F‘1U1'a’{Urfi7aTG1THW1'r%I

GET — Academy — smzrrfr

Report — fi*fiT:‘

aiFI‘31T6ITEt?ra?¥=Frq‘<€rI=rHEI'W,3=~%I11*Uras°rs1T%n'{a=11$?, H&2TWTfiT1¥3H%fi31'g?6¢f?r@9rH?rqEfi$?Hffifi'@W$E?r%lG?fi*'Rousseau' a?‘r31fi?3=a1'<'UT%7a1TtrI?tr<'2?a°r'f?v’I1a=ITI

sH'aifiTqa"f?I1fiq?a$t?s"ra:‘r€I:qfi1?[qa:arIfirs'wI1°ransI1¥an?fi

%i%f?-I12iHTw,wf%Ifi1aw—aiHTa7ra1TtrI?wg'aH:FuI1?WE’?%Ia1fia?u‘a'

%f%f%‘I*2ifiTwfia?f=fiq?%fiaEr1%uTGrIaT%,€rf%t‘FraFffi?qEfafi11w=¥

fi1$firrs1a°rf%‘~I12iFrIw=ra‘T%aTGrTaam'TIa32aItrrt%HaR?1T%f%

3?uI1Twa‘?f?«I1=ia1wI¥%fi91g*§%‘IaT%fi6?,3IE1,H1Ea?aW?fi2gf%uT%?

a1§[zrr?sH1¥z?r%d’r%fiqaf%r$ra17jaTwmaamT%,m1?awI=rI¥rtaHT

%rTf%'qf%‘€fitfi='r‘r9F-?.'El°l?r%111:T%aa‘?1Tfi'al»‘~£E’rI

25

(40)

awErH1TmTu€an?fi%fiFa1H%1TuT%:f%R1°rs1E:%i2I21T?f3?ct1Tw%9r

fiwfiéaafiwamnmfiwfifififiagafimwailwffififi

wga1a259?f%1H3fiI1Twa7ré?9a%waRa2mT%aafi%r€aa,a1aa7arra?fHI

a1mmTI¥aa1§§3‘a1fifiaramnm—%nfEm°fa$W§fifiT6?aT%afrI€H

$rIfI3i6r&?I%4TqT%m°rfi$qua11I&1HTq%a°ra'a'31§H1H$a%f%IGIIrm?fi 5Fl?‘fi%|

H‘m%mTé€f%I?d?s1<a%;f%11:Era2I%nwTI¥qa?#arf€I$3%HRw9=a*l%IH a?a’r3rg'a1a$3H3?q'rTm°f13ffi‘Haff€J%Hmg?53fi11?wa$ranHTaafirr%

€?1?%e+i€,%&1Tz?,%z5r?3n1%1¥1ia's"%12F’r'a7r9ai1Ta»1aafi1T%I ae2r%nwT%mfi3?aI1?Wa'gz,'9?g?5sTa?a1j[a1aa:afia?3aT(w2sfIH%nwT

%Haff€J$fi1arc*a1T,3sfi$ra€9ai1Tar<¥mfiT%'IGh#,fifié,fi*qT€,sH1¥

@r'f%q‘f2"a7rn?fi=TIQnTsfi3°raWrr%i%are2r%111aT%?€rmfi3a1?w

wmmwfififiafirwmamafigwafifilwéafififiaanvfififi

fi7€fi31°f3fi1TW3w°f3€3WHTH3THT%3fiT§?fl1THR'HfiwTfT%|§T|'{H, éTa'Tr§?rfi?J%°rF§4‘f?r%I

s2121aVfffu11aE':q$a1?ra'a’%f%afi?r%n1aTqEia'&2rWwTafisa1'?'r­

mmfi-agafimfiwafi-fifiwfifiwfimwfiql

(41)

f%a°r-3113:—fi31§a1EaR?raimI§?;rQ¢fia1?f$fi%'fiv‘1Hafi*Grm%Hri°r sr§,a1za:€6firQarf?Ia1?fH:ar'3rfe¥IH%*Iam'aTr3?ra1a¥fia%IfarlfI

1%r‘v.‘°rfi‘E."flEI’i°ffi‘IlT?.'°roLiu1«1‘I'1i‘H'g1,rh+cI<21T<igm«2i-1r1cMIr}a?r rrfi‘q1é°rsfia'%I?r%afiTafis'fi‘s”HHTa'23rf%11aT31°rG11?IT%I

(~°»T+q)=fir(fiT=F)

(ar+3fi)=afi(afiTcr)

éfifmfiaaiwrr (5 +Efi=?fiw'(qT=F=FT)

a'1g?5a1TrI=r (§+a;=a°(z=rc.‘)

afifififisfimafiwtfnfiiiufafifiafifiafiafiqafiaipfmfi

rvn?1°r I

f”a'Tq°rI¥s1g?rrfi1$aivI?raWIw#fhFrGrI?T%aTaI=3TvfiI¥31Ta1‘a'%€

aiv17ramW#HT¢r=fiz‘f3??rIf%'7<°r%a§firF€1$aiv1w%,§,w,w,H,wI

Report, Pensi0n,Rate, Gathe—s7r91?r."fEr7‘r?~‘I‘FFrf§‘rI1I| s‘«r51?r.'°f7¥

'e'a$rF¢fi1%rq?H.vRs1?19r29{qaTaWrr%f%'¢sm:r3fiI11w9F&$ma13f 313%! Rep0rtfi‘75?=I7=I?r3?q'I'{UT'§'#Fr?Ta'%FI’rPensionfi“Iz’EI5tFI'~Z’6l Rate1¥a?5a‘iawR€fi*3v—q'fiH%fiH‘a‘Tsi?fi%aTGathe=¥3?4a»'r3?=I1?w

27

(42)

'q'a$rFR‘s'%'a’rfia%f1?v‘mT§3n%I€rWf%Ts°rfi€Ha?Ts'@TéT%Ini%

a3‘£q?:rai'aHearf?raHr3fiI1‘<UrE@"Tsfi3ni41417r2aqz9r27s'aT‘€.*I

3'?:T:f%€7:I5T,?."e»‘°f,I1’ra°r,‘TrFi°r

s1'1i$1°rfi‘a1vrrfi' ’a?r%fiffi‘F‘r‘rIITz?r‘é.‘*I

Cash, Cheap, Coir-s{?r91?r.'°fEl»“r<‘~i°rF5v‘1Q1TTl 3:11? 2? Cashfi‘ C '$'

fi?RTa’3EIfiHafiG11Ffi%a’rcheap1¥3a25ra?unTUr'a"a?r3fifi’r%I 'Coir‘1¥a'a"q'(aa?)a%aTa'a°rG11fiT%Is%Ir2:1$w2Hm§nWafiT

d-iv1v1I-3shH 5!? sic14Fd <L=u u1IdIT§‘|

afififirafififiwfifiwanfiwfigvwfifiwwmaafim

rrITaT%,=I‘a.‘°fa°raIv4‘I3f%#°rcrfi7=I7¥=razTm»—riT%Iai131§FrfifHour,Prizes=r

sraTa?ra?a1°rf'3‘11:IsmT2i*9?rwsTE.'I¥'H'¢z2fiaTarf€marr?réfiT

arrErsa?fisTfi1fiTé‘a=fif%6HE‘Ta?sfififiB%I1Tw'our'@‘raTz?aTq1na?aI2f fii'sfif*ifir%IPrizea$r%fia‘a°rF®1°c'r%I 'Z‘q?.G~rrrc.'Ts2IIHé=1T=z€T' srIEr9a$%,Ta‘Ta}'c'aa'r3fi1Tw's'a7rG3rHTs?GITQ1nf%1'afiar2fI¥%fi n3a€raTq1fiIf%'EPr3:a1aVfI¥ae'f%tf?I1zaT3a:fi¢q1z2aqz%H€ff%1a13‘

217% I

(43)

s1?r.'”fa»T3?:rrIUTaRfi‘Irmr,”a'1¢®'eafir%a1z'§ai°rea1fiq‘(

mwmzafiwfiélwwnwafifignfiafiwwfimamfi

$%fi31¥3HEa'f?mHra°ra'a1eTa1aarI3T9T¢rifiHT%a?a5%fiQ14T3F=I%FwT uT¢rHB°faiHTIIre.'$VfiHmaTI3aTaRHT%I'as=rr'ma'a#€rafif%11zI3H

ma'$ra?a1TwaR?¥amr's;'%:§i?ra1?61I'HT'qTanGrr?r%f°v‘n419(

'aaHT's"HmEananfa?H61?fs?a1?rr%Ia?fic»=r'sj'%:3?ur1Tw%:aIEa'q u+s'Ta1a$mT€raa*31=a1Tws'Ha?€2?rsTGI1aT%f%v:'a:s'aT'Ia'a’ar2f­

¢'rs‘r6ruTI¥aTaT\‘iz'TarT1T%I'aaWr'$raI2f%'tostruggleafiT‘a€=1T'afir 3-T'<’f%Don'tStmggle.31ffim.'fiVfi$r|i'<1°ra1fi°fqT8H'I?r?3'=ITé°r%ITf%'|I|

m?:'a€°rea‘f%21TafrafiIfiHan%ra1:Irsa'f%ra°f%:a?a1?w%:a?nam+q

§Ié?31Tm?qTafifi$%fiaI2fI¥%fiqfia?f=ra1Ta1fiT%I'fhaT?'s1¢s16.*

€sa?a1?w1¥G1°ran$ia1T%d°rIaa°r%',aé's1TsIa€I:zrm12rwisfiaaa1z

'Got'I¥HE.‘TaTaa»?fiaflTfiraTaf=r1?%fiH'a°rH’e‘¥Hn31TaTq1nIa1'ga1a$

a?r9F&$w1wTafiarf*iIvIf?=5-nvn%tu¥2&¢fi'f%1fiBiHTfiTi%*I,aVfia3_a'IH Hr2f$qa"anw%f$€°rHamT%I

39

(44)

1fi'%'&73F;;'cl'|3'

f%FefiaIfi5§rUa¢é”r‘g'3‘a1Ha7rg11'%aIfi5§I?Ti%11?a1Ig%rrf&aTa»E?r

§,E;Hfi»“Frn*r%3rf11?%If?~rfiaHs1§:11?fi3r&&1T1frF%fifi~31§HTa1¥

¥@?IB‘E'I1ET%aai”f%13‘f'Ei$a§a1a*nfia§firaaR9r%¢f%N3fiHTHnwHfi fimHT,a%?HE‘TI1?ra?5r%3fir1?wa?rf%*f§IEaTafiafi*an§F1T%fi3?I<47Wnf 1¥gf*?=‘=mt?aTarI%m%In‘rFé1iag'a1E%sFfi?%fI¥%Hf?ra:rf%sWnB?q'

%I

am'a1¢éIa'6¥1°=t:n’rf%$31Tcrfi.'%:¥mf13fefiarfi?3?THanT%Har%—

¢f%r?i=r95aHI?Ura2IT§3fi‘<sm‘?rfi1InEa»Tar”Ta?»:arre?rE‘='?

1.fira11

3Tr§f§‘#3?3ra1€rEHf?r¢i'?*FfH$rqa€§@Ia?ITw13‘r&1T%If§fie?IHQa‘

arf§rf€maIFr'5%s?=I1?wI¥aTf%$IaTafi?fi%,3??3T§31?=¥a1HTarrq?r

§%Fr%If§rf%Harf’v‘fia?raTa?$rara1f§1fE+HaIFr‘5a111Ta1§a1zar?aT

arf?rfEmaTamfifi%Harf%5afiaTaT$rfi‘rf@IHaI%31§?IEar?,aH H'n1=ITr3ai?fi%Ia€H%HwnTf%2saI§afifiz1aaQHmwT%,a"f%

f?~rfia?raga'ra%é?#fi%fi3m?zia1Iam2IriziFfi%I2sfm%nmQ?

aazr%nma?TaRrfi}as,q1If'Frq?3W«IGrI?$R°r%¢F£§saffs1¢aw$?Hnsr

(45)

f%mTtvIT2=Ia»?1T%I

a1§a1HH:aTg'%11fiaTI1Fr%nd?a$rmWfi1awf?«u1%rafi%fiHnsfirI¥Haa1I 6’r,a"s1°r21‘a.'H11121Tv2$e?a$g?vI’§1°rrrIT21T=IfiPr%I

2.'zfiTfii%ra::r%117:r

%fiTfi1‘%fiHm1Ta%?a:ITw3?cI1Tw13fG1‘rf%1‘9Tw?rrE6i?fi%,3%HnsmT a*rI3Ha7r(%Hf%r%:z1aVfI¥)a§1j¢ra$1HT$f%H6¥a1fiTE"Ia31‘a'?wza1?q wf§a'd?uésfia?rw*rTfii%1$f%I9iuaTafia¥afiI?wa€"Ta1=3EfiwTwTaiafiamT%7

afiwwfiémfiafifiafimfifianfiafinwfimfrfilfifimfi

I¥3113Efisa'f?I?ffa6ra1g2rrEafiHmrafJ,a1a$aTa§%rrf€I1za3°rHH4WIT a1fi7fiwa?fi%a¥fiT3t:a14a?ran3T1¥Ira*H%T311aTf'?I»‘afi=r-2fiEIfi$r 3fir€w§,'3n%afiT3a$rf%aPrI?ff%FHa1€a3ruaTwz1HTaTf%1:Ia1=3v1°rI¥

Ha%¢saI?mTarrafiIRwatéT%afi?I12%aeaf%ta”T%fiam”T3?=Ifi‘fiH%°f31?fiI a1i1a1a$avrarf;'%r¢é’rs'21:r1#1TI3i¥m1IIasawaa'a?tT%I

3.rrI7j*a11wa»'rsn=I1a'

mFp1TwT€fis1“3na€t:a7r?w$%1°r$%1’re11ws?rffi'a¥$rnFr?r3?q'r<UT a1€r%Gfima1i‘HmaTavr$ITwa¢ra1fiT%l3aTE»'?vr9fia‘t?qTuFm1?rn

(46)

%qEHfiWI$rm1I%'6fi€i"'f%H$rf%IUifiTW3FéWfif%?1TG1T¥F=Err%

FFKadavuI31=rkadavLueHrfiaWT$3‘ai1Tfi'f%aTGITHfirr%U?13‘f%':

aE€r,afi.'§,a7ra€*,afi.'W,aTe.'Tga1‘f%IHmaTIE??Hs'%f%S?13fi‘afiW—m

mE.'3mHmTsr1q?m2Hfimfiafivkadavua?rmfiea'fim¥fi¢f%f%Hafi

9r7EfiI‘£Urarcr?‘rar*19rf%++:sH‘13<+qndc=1u<uu«=h<&%a°ra1313fIg«=rImIITa1I

m?:'2%a‘a'$rq?r§?3?mfiT%I§12vfi##§rf&af%‘f%‘HwTmaH:ffi»?Ifi

3?HTN3f%3fifi1?%?4?Vffi°T6’a1HEW?Ff5fTH3FPf%|$3fi$3fiG?UITTW, I1?rw.'fisfiHT§Te?Gr1HT%f%t7,¢f‘2*I%IHm?r.'%fia1¥a=rm9rz#a1fir%‘I aj;'a12a€fiHfi2i?1T%7fixIaT31¢HmaTa7rafi3‘afiTIrnTHmHvRHE°fanaTI 4.s1a1=4T!1T:4'£r‘=Hr=m1a'

a$raT3m2n%:a1f[zTRaJf%'nIfi%:3?q'1TwI¥i“31$taT3n?fi%,f°w‘ra13f afi3‘a2%H€f%I%rRm?r$ra%fir,qTa'EaEfarra??a?rHfi?aq°afiraIf%5a11T Qaw'3°rEtf?ruTa?r3fiIRwaT%a?f*¥t$mTHvi?an?fi%,u21f3'3141¥aWra%fi uT¢rE?GrI?r%Iaf1a1a$fi#sW%fif?m¥a9rau319r1§a?g'f1?éRvr€1fi°r%,m?I E?rHPI3=n¥3?ut1Tw.§'f%uIa$raq6rrz19fa1HT%fiqamI$f%=rs?a1fiT%I m=r6fi‘f31Qf%f3?¥fi$€r?Fr1¥q$afi?‘&:H1?I?§%a7ra1aiFrNf%f%1Hf%FaT mzT%’3fi?a1?;a1z$#r31§err?ff313raaR?1T°é'Iac—%"afiTa;%r%3?utr<w

(47)

a?r%anrr?na:f%tshfiTaTa#,ai73H%a1af?rrw1¥%a1?mHw3?uIRwa?r§'f%

#a%3iaTaifiT€r,s11afia1f;a—raI¥3a119r1¥,329rQ$?W3?f%?I3‘3iTfia°rI sm7r$I?wa?%1TwTa?rH'a‘fe3If?f?§'Gfi@3fiT%J1HT24°r@%r#z#aWq'%aT

§a1‘T3fiTWWl1Ufa:$fi'@?r%q3fi1?[31#H€r€W#arf31HI?n"HaT¢fira$r snfifi$aIe1naT€rana?s'%lfi‘f1“2rf%m”Ta?9?3$wTwTah°raIrFfi61?fi%‘

f?rIT€*3rgf:rr?:I¥a1HTgEFI%'l

5.=41'=rRI$@fi'r

ai?—1=‘Ia1FITaz°rn1¢r1%c$f<fi1%‘$r3114?aH%r7afiI1?wq?%frrrsrc1T%I Q$é?f%I‘w'm?2iaa'9?h5aTf‘¥‘5a?r91?rf%»“aT9fi3$aWfi3i?fi%afi?9'g?5 fi:q=rIfia1?rwE.',sa1?m“f%fia?Iva1aw2?6i€I’%IIgawd?e?a'f?IwTa:r 3?cI1TwnT<'Wf%rfia~1?r%‘a°r$%sr%4Td?Ig§eafi21°fa?r%fi3fiInwuis‘T afi%maT%mwaR?T%'IQ$E‘?arf”r‘5§1?TaIaWziE%¥I¥3?uIfiHa?rGrIfifi1Ffi safi'a?fi%fif?131fiTa3I?3rEfi%Is?T¢fi§9w1¥a1f;a"I?a?r$f%“m's‘ea19!fi a?rwsgzatqera#maTm#arf%4avsa»1%rz9rarra1a'§*ua-fiswwtvrmam fiT%If%6ah¢waTz9ra1Fré?GrIfiaTEfiIg§sa'f?r%fia1Hfi?r:fi111aHTaa=?fi

%,3Pffl5f3fi'%faHTFfifi‘fT§'|31j3fi$35T§HT{E’TfiTEfl'Wfi?ITWHT

%ITf%1;rI

(48)

6.g1=srqai2=»i°r%111:T13i3ia?

mJ1?1‘g$q¥qa‘f?‘:ta°fa?r%nuTffsrmEFI?qTafi%3iaT¢ra‘¥a3fiT,f&r€

%fi3fiRwa$rsIa:rfE5aHT#%:f%n:E»‘fia‘fia?ffisItF1mTG11HT%,3H%

1aIIa%?é1a‘aMfiaTa'V1?=rv1T3nfiTa°r%Ia'a'1%3iwaTai13vfi%nHT%H#aVf I¥f%1FrHH:sfi”fiaTaWfi%‘Ia1fga1H$5I€fiI1zs*HH2Wff6Ff%?rrs°a'a'%f%

afiswfifiwafifiméwfiwqaiaafiififimwugfiwfififiafié

s1a?HTa‘T%Iu'e'”Tq?aEra%TaTaafirr%1%I1r—r%1Td’ra111?g3waTa’r a4f;a1a$%figWeiHTafis*T2%Tn3fi?I1amn°r%8fia?,a?aIga1a:5a:raa°r

sfimfiavfiwanmmmnlsfifiafiwwafimfifisfiafiwafifiaaam

aFrs2rsITI?rz°rH'arPr%I

7.

§a1g=amafiI1Twa5rH1?faH1WT€I¢1?~r1zaH%fia?%figuT.62Hf3raTa?r€fi€

f%11TrrI1'r1T%21TGfi:«.'f'?:‘I1TG11aT%I

3aT:q»T—ré?f?-‘1'q3?§ToHal°r%f’o‘nz317:fiG3raT3fi1'<UrI

anrRvIa:2fia'3fi11w€I:$rIw3ifiT%‘,@1f%¢r$%fi$%fif§‘rf"Ema:f'?*5%fi

§'€§'@'3?TH€RT§F?f'§|WTWW3§¥F."ffifiTRfiE'§7§$THBTU%WTHTQ

(49)

a?3a?fia'e‘T%rm21TTapf3i?fia:fifi:argfc11H‘$a1€.*aTHE°ra1T#3TW 3?ut1TwaTHa?rr%aTafis‘afi1wnfamHTHa%IT%I€rf%«r=rfq’?é?aTf%“f%$

f%*aT1¥f%d?3TmIfi%a11%ra?q'afif%fir12HTaT$fiq1zaR%r%:aav$I¥fir<i mE:Ta¥r,ea1?1?fia»"rwi1Tf%7qTnaT%,a°raErfi3a1Ié?aI{j,a1a$a¥firq

HmaT€mTa»iTfiI3H61amfi31§aE$afi,ma?31ajf%Hm?:'fisHaTa

a€rafi'§¢fiH?har<HTq@WH%Ta%3HaIf%52ianfira?q'a?rf%rf3I12HTaTa$r fi7d°rafiTaW1¥W1:£aHzHTqéTnIa?%fia?31f;a1a$%i%i1:a?;qE5Hm21T

%é°rI

8)a1111Fr‘I7=I~'r::1fi-‘m7,!=i?."3*'r

HTmfitEH,aTFfia?¢fififi1?1'aT$rm41a%n1:Tq‘&ea1‘3I'aTqTa:%1°ra:%fi qaHTa‘?%,f%t?£fif%‘s11Wn1vrI¥Gfi'éa1€raififi%4TwT,§11’%an1vf3§a1Tfl fimuT%?fifira11:Tfiafi3‘aHTarRvmTaTmaWrf%IafirrHE°f%Isa'f?1aT%

'1iEVfI¥3fia€a1fia1113?Hafifi%lg'a7v1m1Ta7rq$f%‘9iwRfi€IT%

aR?THraRwafiTfi%1%I1z§f?=Iu7-ré°r%Ia?anEfiG11H€1‘%‘,aE.‘Ts?WT 3firRWHE»‘Ta‘Wfia»Tm?r%3fiT'3'@91?:'313,ErI?%m1ffiEFfi?I'§‘3HTHuT 2%r%If%I?fiHn1vra%f%I3?waTaT#rwTf%mz1aVfI¥P41zaR€ra€?ffi‘f?rff

35

(50)

%fia§a1aau"a?rs1IaiTara?r$f%?rr3‘6°ra$ei°r%IHmGrqa‘a1$a?ra‘a'I¥

a1ar<Grm=5T€rE'rf?L1?I$z9r%:¢m%rw[é°r3HaTa'a€%Hm2rrEzg:1afiaT

a7=rcf‘r%I

9.s111FIfi7=aa1=1aT

vn1°Ifia€aa'naTa?rsr%11a'afiI1TwqT$fiqeaT%lafi141fi1I“f,aTI?rf%?I afif'1%tf%raTf%aIi?5%73?q'Rwa#mnfiHqT<?fié‘,3W?afi3‘HTq‘€H%°fI '3'Ffi%I1°crI¥f%IréTarf¥5a?3Ffi?Ea?rfis¥fidinTfifidTf%H%,fiafiIfi‘H eafi1‘fia#an3raTafi?3mafia¥#r3Hfif%‘F§I12HTa4°fa%m?I91§firaRHT ar§aTa$é?f%I‘I$f3FI3‘§aTafi?r§Ia€Hm21Tn*I1%a€ag?E%7fiaVf1¥

3:fiI5rH%°f6i?fif%1FFfif%firf%fiaI§a1a%:Fia3fI¥f%?d?a‘l%5#a1fif%I$

f%rf§rQaTs1°fafi‘PTtEra?<?H?z1‘<'%fI¥3i?Fr%I

10. arfififirr

ar%fiawfiarf?1sraT%fisaf3'rf%ta1w%H1z'3f=¥afifirIa'a5rqa€amaTa=r G11Ffi%Is1FrE.‘°r1¥9a:rf§rrHq$f?5aIa?rwrIr%"DaudIf%T<°r%nuTa$T Ifif?IfiGrrHa?IfiT@5ra1€rQ$arFr‘5#s14$rFo‘fQ11fi?w§HFREr#fit?aTaT f%'a13a"Is111i‘3?TaIf?fifina?r=re?fH%TaTaa»?1Ta2fff%r»‘D,A,U,D

(51)

sHea1°rm’fz3(as*¢fi“f%IHé‘afiT3msTi%mia1w§Ha?mhfif%aTaTaa»?rr

%IanWruB‘fa"afiaiFfi%GTa$fiaja1a$s"Hf¢f~w%a1%fif%HTGrI#,

31IarIErfi€t:1§'a'z?ra€H11I2gH€r%¢srEu'1?[3a%5T9a°rwa?<9ranaT%I

11. aiwq7='I%zrf=‘=r

a?fir$%fia:%figfisa'1‘%1fi$r3?=tRwai1w%:2#aVf=3fa?<fiT%,f%114a?r Grra$Ifr31‘g;a1?:‘qv5l?fi‘—11zaT:‘v4TarI‘ersw%I

Heistoogood.3?=raT6F’I1?ft00Gl°r91?:’31T?1T§‘,S'H$THT?:I'I'('°T

2='ra*v'rfir‘ar2f%'a§’vr‘

'a€a§a'arsar%"IaH‘?r»7rainI%:¥ra%f=3fs1Wr3fic1?UTar<=1Ta’ra°r

'too'a?ra1:=.°ré?EfaT%:a1?I3%afiaTf%rrarrGrIaT%',aHaI2f%fimw

f3‘¢fifis?a1fiT%Ifir&9ai1T#,3131,a1a$a1Wf§firs?aT,a=ga1a$a?rHn3T ff21‘a'a1?r:fi:fi3rr'1”:‘E'°rai*a?f%=rI%liaTai?Pr%I

wsfi=Pra1aa1a'

H?fi?Pf3Iffil1?%?13‘f1$?IEs'3fiTFlTH3vT1T%f3?,S?T&?3rfl;Eafi'@

ziaaamaTE3a?fiGrFéaTe’f§l's11a:r3n1vrIr-a%f‘?tWB°TmHa:fi~‘tfir fim'1Fr€Ha1Ttrr<qTai?r%nqTa$Tsra3$eaf3r&:f%—rqarazrwTqTfi‘eafir

37

(52)

f?n2rffiFra?rTrs‘%I

f%rf?aH,n°Tffa$qit1Tsfi?fia1§;a"rEa?rHm21T3fi¢{,an1Ia’rIq?f%t%r1T asz%r%?q3HTqa€%fiafiTaTFrasaT%'f3t€s*d1¥fi‘9Ffi%fi&i€ra§”r3m?fi

IsaT%I

f%rF&iHa§HI?%@Im€raT%a?:vagErmfi§;3}aIF€5a¥asTaWFfiH a1fifi‘Efi‘c:Ha»?‘r§I

1.2ai?rqa‘ara4I%1TqTqTa111¢rarf€J?c?ITua7‘tamT

2.afia'%11uTa?r¥rm1WIqa‘ara21WwTa?rq'a+l?rGrm$R°rTta9ia1aT 3.fi4T%a&2n1TqTa?rGrma?Ii°rT@9raTaT

afi5'9r$TImW«ra€%f%fif%rf%Ifi31§ar:afiéaaaIf%5ma?wrfie1$

sifiT%HE‘Ta?a§;awIs?Tuau"I?¥rd?aaff,aEafi%:a%'f%1'$f%«Hf%vrf?aH a§?ra#n”rf%I$affiI?fi1$r3iaT%Infi1%$ar;1',aW?g?fi?<3F39ff3|'*aFr

a'fiaTa1#a?rmfimm?Um:afi§H€fHiamInifia$a1§?raI¥awH7 trirqwqtarmaafémmm %afi‘£3??aITtrrTtr<s1wr3ma1a=r%fi

6fifiT€.'Iu?f%qa:a1§;arIz$rt47mTm1r1TwaHfiT%fi33Taa:m%'I§tfir:rs1I swgwraffsrzffirawéwaxéfifiwgawasan f%rs‘TrIuI1=r2's'¢1TaTF»?»trI

(53)

nvfifiwga1?a?r2iafH3%rffi9rarfi=HaT#%a¥?sF3E;'mHffa$I3‘1%t7sfi25T a?U3fiHi»‘T%aTI-31§a1?a¥37rafiH?a%aTa?ram21Tsfiq?f%I%I1?aR?rHnw

3V'{i?fiF1“221>fq'{3?f?{?r1TE.'1Fl7lT31"tE'f?'é’TFr|

§HmiWI3‘%211aarqa€afiTHIfi3131,a'IE€IK&?a'1i‘arF€:a?rf€1$aq'ai1T fim9ra1?‘r2Hf?rf3a1H%wTeh1a‘f%IH%'Iswfia3f1¥eHt?rl%aW%:§@1H:

a°rn$R°r'a7rm1Tf%ra'rG1THamT%I

1.avf:rI?~q$r=a'ffi'f%”:I'rFr

2.§1f~FrI?n$ea‘f?rf‘?r:ITFr

aTa'a°raa‘f%I1%?r%'f3:a1§a'Iz'a?%4TuTa1°f%:a°I?a’aiaT%3fi?a¥H°f

mmfiafiafifiafimamagawmmmvfrqaqfiliawwaia

Q?'6razIWuTfieaf?ta¥a$r,3Ha?rm1°rf%:3’rwaTaT%arIaia:1¥qe?=I1HHT afiT3H13f#aaffi1$3f%tfiaa'f?ra»‘rs1ffira1¥a1?rr—u‘a'avfa1HWQ€T

§amm$Erf?rf%aWa7ré?EHI1f%3fi?a§a1aa7QEraa'firf%fiIW%:qTTmfi$

a‘a‘er$ran2rr‘<s1°ra1§1,?r:?rzPravzr%‘I

31a'sfruT2fisHf?rf%31W€fiz1EV$ffag?wfffi’°31”§%fia1F‘rgfif%‘fiw

3fia5Ta?w;3rm$raII:ran§qar<aTa'I%TnIa€Ts?Tq?arI?réHTa11%'1z

39

(54)

f%2hwT%111v1?r:%112i?1'n1T,a1gfi1a¢r%:2i?.'“3fI3fsrg?5 %1zU—rr7?a"r€rsW.'H%°r

%,6?f?Fran1?:H%fi3HH?rf%1viH1WaT3r§_'fi1a?an?T%fiq€Grrqa?3Ha?E=' afiHm=1TE6i‘m?Fr‘€.*I

l.p00r—gHT(tr+3+H)

door -251? (3 + -31‘T)

r0of— 75$ (T + $)

Ta"f3i1i$fi€fiFfiH?s1?a'T1¥'0'sa'f?r$r,a?arIHai1T§'3n%Ia‘rf%tFr FfiHTs1a?I¥sH?Hr3?rRvr3mw3rawa?m3r%Iq‘a'?‘f9Ta'I¥‘q'%7mvI'3’

qa*'a'ea?I11°f$rwFfir%Tw6?naT%'a’ITaB?'gaT'€52m1¥sHfi9T3?aT1W

%I§14i'1¥'€'%a1?Is?raaf?mT$rfirarw§aT%,€rf%Fra?=I1TwI¥aE"a?' G??1T3?G11aT%"ei?'I'2a=5'm?:'=¥sH€:'f9m¥a?r3?ur1Tw'$'G“rm6TnaT

%|aB?HW3TaE'%f37fi?€fi31ffi1H$5}?m?Ta1R'Poor'w?:'fi‘v1Tfifi1W3?

f”v1‘I3ITfiT%a°raTaR€'HT%'3,HT'3fiTS?fi?q9?=I1?[3111?31fi:aTq9r 'Door'31a34T6rrqa?aB'sH'a?rfin2ia1w'§,aT'%:"6w1¥as?aHmT%*Iafia'9f

$TWfifiHHE'§'f3?Q3?Efi'83‘FT37Tv31FlW3WIW3'fil'RW3?jfi1?3?m1ffi‘

—31a*mar%=rI'a“3ETaT~:?2'aT?3'I

(55)

Present

(gm?)

Please (ayw) Light (SW) Bank

(33?)

Watch

(3%?)

Present (strfiim am) Please

(gw EWT)

Light

(WET)

Bank

(WW)

Watch

(fiifiawr awn)

sqfivsfiafifiéuwafiqffifigvhzqfiaafiwafigffifi

HWm1fi:q$é!°r9EfiRafi%‘Iri11’rea'f?mTz3ra9r§*qmaaa,a13EF%€m1I 3rI??%aT34§;a1HEHa#neEre.‘?a??fi%If%f%I$r3I2féfia1€r,anWtafiuTzi a9rs=rs1E'¥%:f%2fi@qaT#a?s'arfi6?a1Ts'#wfi'I%Ifi€}a%,31fi%uw=¥

a€Hm2rrafirmaa"33fi*aTI?fi%f%3Hm'aafiaaf%a¥%§H%wa$t,fiR¢

FRT:r€r3m1Ta?1Tz3rPTrz%aTaTHamT%Is1?rsfrI%fia1?n"W'rGrIIra?

(Please)E.'°r3RféfiHmT3i73?rfififiQ$91E’§‘f?rl'H€1?3ifififi(qP+qL+

(56)

3E+qA+2IS+s'E)sa¢fieaf?ra‘Ta1TF%°r%Ii#a'%f%%aFor£rrTar;1,a"IEI¥

'Please'$rf%1121fi?W'I3fivr‘—sH9a€W2%1'?IraT%I3m?3rg;a1a2Ha?€m1I

‘1gwas?HT's1I3I?fI¥§Hs1E.'a?r1°?Wia?Wa?zfi‘a?r?fiafiaTGrrq,a?6fia' q%3n?rEfi9ra11aT%Is1¢narI?%a1?I9Taa'H9a1aV$=¥%frIir21°rHn12zT33

ya»-cfi E1’!

Check Cheque

won one

I eye

Coat Cot Own on

Dear deer

am — efiv

awn? — 5:31?

2}%@Wa‘#'g'f?z%?f‘¥I$r,fi%7g3?uI1Tw€t:@nTa2iHn1w%Hf?III”T%,aT f“¥firf€13r3I2féFfi%‘IQfiwaT$Taf;aTEmf?rf%—ItdHTw%fiaga1aEH%srnT Hm21T‘3ETaTéfiT%'l§HmE:?553I2f—31H?a€r,%afi1?fi%?uTH11¢29rPq1z

aR=?$raTf3Fur31§aTa$%m':ffi31a3wq$aTm%I

(57)

(fiq?) Minute Minute (f%rf‘3I‘<I)

(fig) Wind wind (33)

2?é7a¢ra?regf%2iHIi1¢r,qi§'3?ci1Twa?r§jf§:2#f%r>r2a'f?m'T%‘,a?

aanmféa°r%lsFWa'Téwf?ré“a?ré:f%*wIH?i$i3°$7%‘FF§3¢f¥\2iH

HE“faiFfi,aHaIfai1aEHafia‘a'GrmHTfiTf%‘:fit€aE.'arg$mE:%sfi?srg$

n'3“%‘rI3i3F$rSi?J°rrr§siT%I

Technic - Technique organise - organize

&3I2fQ?'9ai1Ta$r§;fi%19rQ%F“a°r2W1¥9?g,?isa?rGrIfia1?vfif%‘f¥i$r

ea-finfi a (nic, que) (ise, ize)| 3?’??? snfiw a»°r 5} am: at‘ qi~m=Pr

3¢F\®HH%°i€i?fiaaifi%s?1?ffif%i¢fi$r%fiuai1T$%aia%T$i'§f§i$mT

=i.viT=i'a?fsiTq11°rI

Honour (aw)

Psychology (aafia-sfi)

s7r91?a*fqT,s?ifi€3?ai1WrqTH.HTé.'1Ei5r2iqaT%imrr%'fir€3H1¥e3r mmfi'H'$T3fiTf%?fi1II3f'P'afi3?=I1TweiaTFrePf%I3:qTiréIa9rqTirm

%fiaTmT'§.'fia‘3wmE?fifi,a11?3Haa'f5m¥£rf?i$iFr%fi1%'wTwma¥afi'§

43

(58)

qfia?fHaEfi6?HTIa13ga1a$a5rfi?¥WE:H:9ai1Ta?ra?e§°r1arefisrman1‘%

afifi aTf%E,:réT a°r 31313:? eazrrarqa‘ STFITWE a‘T‘rTrrI Know, knife, Neighbour—3n‘f%‘s1E°fa?r%4’rII%°rffi41—?'r?;I

f%'&‘?QH'3i‘3vfiwETffu3;,?5aafimTa?rQ$f%IfiuHra*a"%fi%'f%t€1%EPr

fiaaf%a¥f311¢a1€z9rf%fi:fiGIT€fi%,3IIaT6fi3Ha:r3a1Tw%fiaiHrE1*I HuFmTaHa?r§"f%23(&@a?31Ta1Ha»"r1§3HfirJTaTHa»?1T%,§r%?r1fI'&

a¥rq?31n¥a11$rf3a»?rra§?r%l

37f91a’r'«‘=Hr3?=I1TUrI

é1‘%Frai13$fiI¥ffi1°cr3H1?f?1$r%IaE°Teafia°fafiQfi¥aTe'23rf%~riaT GrmT‘é'3fiT3Havr3?aI1Tw?gr%a1T€rBifiT%InfiT~firHE»*%a‘I'=a:rqa‘

3?q'Rw%atfia€°Tafi3‘m?IfiFrH%T%IsF$rQH¥aniWaEa?H$aT§‘f%

w3sfiau‘?ar&aTf%E‘T1¥safiaTafiaTsa1?rf%tEa°fa?r2#Ia1Twrm'T%I

%z=rfiI'I:ITI=r,ziea'F—‘tqa‘ar§;?=I13'

s'Hsra?1?qTtarf?1=Irwqa‘¥f2af?11fiafi%fi~31f;a'rEa§z1aVf=i‘HnsmT 3%Ifi6inTI3T.%fi?rrwrwf?1a11°r:?afiraT%‘f%H2rfiIwaTsaf%u1wa?rHfiT wFrfi=fiH€Ffi€.*a?n3q1a=ra5rH?1Tw‘Tf?1$Is1wa1Fr§rafi3T3fiT2I1tzar(

FT Ffi,

(59)

a°r,§?11T,a1?fi,a‘fi7r,?:H—3?rwE.'T1¥Hn1H$qfif%1§13‘a‘?‘ra1FIT'aj' Erf%a%%',a?#6Wtaf?i1rm$€?r%I$r1%'fiwT¢ra1?1Tf?1$§f%2ii%awa?¥

a?s1¢'e{'eaffi‘afi3%aRwwa3HsmF:'1?ff‘¥I3r%In?fia7ma'fi‘3a1?wa$rs¢r f%f%‘uaawTaTafi6W'1#2a1?1fi'a=%iNf1a1?w?€H§fb?lE€WT€rf%Ia1T$%

a?¢maafiT%1%a§1%HeHfia?mf%I121HF<'H,a3fi‘fiaH2affia°Tm?afi1¥

saf?i1J17IH%T%a'f%m"Freafi11°T%IS??r3fiT%fi2111zf%:7eTrGrIIra°r

2?; <a°r>

:73 (WT)

3%? W) W En“

"G: i WE; <a°r«>

Sf; <e:‘r>

aB°Ta?HwTuTsafi1Im'q'a?rzfsaf?r‘q(3)‘avra1§;7r:f%112ia?w§a1T%

afRfit*2faTw&?HmIa?s'¥feafi‘qB€rEramnmaa‘f?1vm'D'fiqfia1fifi

3?Ffi€.',f?tr<a‘a'aa2nnma?rzi2af%'Da'=¥f%rQFrfiHa$ra1?fi%IaB9raw nfim'aEf3t63r§aIHa1?3'H:maf?mT%:éiH3iWT%,Hfi::aaf?rWn¥%:a%'I

45

(60)

u3°T31f1,a'IEm:'fif?«Ivimwmwf%tF?@?%:¢fi“wTsa‘fi¥rwsmT%fi3firH firm I

f”e?7q”rQEf%11iGfi&HEIa¥a?rf%rF§I12fiT3fiHr3FaiH¥fi?Efi%r€Hf%I1?ia1w

q?§F52'f?re#waR9rq?q$aIfi613fWs'%fiHsI?an?fi%‘f%f%‘a‘”r=%6aviH1fi s1Ef%1vifiTw%a1a'3F3?fi1$za1THa?Grr?f‘€.*,f?rfinfi:§€¢aTi%r-HTHTQH 21aw¥1¥I3a1BWr%:afiTq?f%*éH:'=gwT,f€1”e'a11f€*mE:H:f%ruiarwq?

?=IrFré°rB—I1:Ia11iGf°rffé‘amT:‘GL1pta'q2t'Sinha'aFrGrI?‘r%IsH:r<iITfi‘

umaIq$afRa1HaE%f?I:f%T<°r1¥aB”Taref%Hf?4aT$ruafi1TeifiT‘%’mfiF[

(a[+a[=aaj+a§=a%fi)I§r€fi2afimTa€T9afi7TaifiT%',a’a'T311ivfifiQ?fi ea+%m+aaraa%wae°rf%ma1aT,'a~r's2h1f‘%vraw%ra:f%rqav3:fi=¥'LLA'

a°r1%R<zT~'rI1aT%I

a?s'f%Tq°ra?rQH€'aTf?1?IHafi§raTa%fié?%f%‘ia6?f%‘rWa€rf?1vfa$$fi

€:'f?m¥%:a1TerRq?%fifiraTa1?rr%IsH$ra1?q?f€r6%f%3r1gH:2a?aT aivmffa14T¢r3fiH1?T91E°fa$rIai°rf%WaTg%I1THn3?Grr3ra$rqa1%raT

93-f?-rae?na—i%m%Ia3,a1a$awnsHu§f%rfi¢F€i%H%aisfisH3fr:

fiFr61IIfiT%fimVr€THHa?fi%I‘I€¢f%$1'rH'€tH1aVfI¥%fi3?¢a1H#r$rns1T aTHa%HT%I=ré‘rHE=‘TQ$%Hl°«r&:a3Fr5rir%fi%nuT3fifia?mf%W.a?mafi

(61)

§'f%fi‘trf'?T:I?f:ra1Tm»—rrr%I

Sit Sat 9?; -WET

W (EWW W) (‘°iW=W) (WW) (WW)

aF=rr— Man —Men aa —a%

(WW) (33???) (WW) (aw?)

f%T<.‘°r13ff%5nTa?r?g"f§.‘2?T31°rQ14T1Tfi?I?f?r§I::?-'I%lzr21T

aearr - 313%

(ED (Bl?)

firaisi

%a"f%‘%111sT$ra1T&rr<E'TFf’r%3fiTs11a?I?Ur2i‘aI§;a1‘<'%mi1T=¥

saf%rf%a1we5rf%'91wneEr%fizBaT%Is?Tfia%$1¥IWs'a%TaTW1T%f%r taf?1a¥a$rwf?fifiHa»1fi‘aEr§f%#wi$fia?r§;aHT=¥,f%E‘?%nma3I?5zi9r

%:arav;[a%fif%T<°ra?reafifiqT311isfieafi1a¥$TFIram11a¢fiFIfi?rHaiHT

%I@f°aHa3?q'RwaE’r§f§‘fia§HIaI¥ea'f9{a?$rf%‘siwn'aTq'?€#%saHw

a§?Iz$rfl?4Tfi3‘%fi¢aIaWr:H%‘T%fi?2afifi3rmfi3iH3?fi6Neaf?r

(62)

a%i%f§1tafiTaT$Tsfia1H%?qfifi‘a2I1¥aw3T#a?rFra.‘Tafi'f§wTa?rGrrJa?

(63)

m@amafi2

Qflm

(64)

s1f1,a"I3'qaH1TuT%91E.-T$rg14i°r%nwT%s1E:T13fHnWar2f€I:errrfia qTa4T1°rW%Ia1§1§rrEa?rnf%IIT1¥aI2f#FrmHHTq?a3ré%r'§"q,mE'¥%‘s mrmT%H¥rr§3wq?a?rf%aTG11aT%'ImrmT&HHI§?2r23tn?m6ra?s'H%Tf%

mf$?i3i€$Ita'f%*afi§f%#HnWmE.'Tq?aWr%I'3I2f'€°r3fi?IEafiGrm

%3fiT'3r?f'mETfif?:W1€fiT%,$Ha51Twfia§m?%?fi?%ffimfa5rm?:' fiafRmEa?raI2fe?31aWHéTf%aTaTaHfirrIagErraq?f%afiaR€rHmr

s1a.=1%srFrqa*ar2ff%tsrmfi:qTeqTQ$§14'H:t1wzfiaFrsfi?s=rafiH¥q7

H12rH1?If%T=I1?arG‘ra7ra:ITUr%1’ra?%1?r:=rra‘T'%I

s14$rqa€a17a¢aIa%'%fi€.'f%I791E.'—fimTafif%1a?fi%fi9vnF?~ra’r’%', 3Haafi3=¢g4aaTaI?fa%a1143%I—3Iuf?[anf$?%a'=?fTi§a€?E‘?m?:'aH1€r

#f%tf%raf%*f€m¥f%rdTHa?ra1?fi%‘Ig14%mE:T1¥aETa1wa‘TwTwTffwq mE:aan?2rGrr?r%GIErgTI€r91E¥1¥sr2fa1E=Ha?rsTf?5aW6?aTg11firm‘a:

Frq3r9fifi2==rt€aR9r13i31'mI°4‘3°rI

fi:r3ffEi',HW?‘lfifi2?E3v€TfiT%TelFfT%f3?9TE'fa3TWQfi‘3T¥fi%?f'H­

a1H¥WqTf%aHa?raaw—3mWWF@T'3Bfi“95aIaq1?%fis13ErE%ai3rfi aiHTq$§H’I3:‘11?Ha%aT¢rarFr%‘faiT3?fT§'f%afiw2is1¢q?f%‘?4TrarmT

-1‘)

(65)

%f’r:ff”3?I‘rrTa"11TI

sfi.'#wfi*nTu1qa‘:ra%1%:1%awI'~r

'%4TqTf%IEI1H'1¥a¥.vfi?rI¢rr2r1=r1a1fi#s1E.'a?r¢fi‘%nuTaTé°r%'—

'91?r.'sI?f%7za'<*qTwTqTa?rar3fiwz2I?ias$r%%I"

s'f%1B111,F=IHTQa‘92fi1T9r73nerr£q?91E’f%:g»?:=%ia'1?ra+f%H f%qn1z‘v3*f3mfiGrm$xi°rs1I2iaVf1?f2Ta'I?Ia:f%Ia's11fiI§f%1B11¢3:

trfi‘<;s2Ir13r'rzT?-='rfi=?5‘fi'<'§I

l.a?w=r

2.FTr‘33l7=T

3.fi€"sfiaTa111m

4.22*sPr

211§s?r€5é5T2WI¥f%éTI¥9?§asf%t?qGrrfia1€rsra2’fa$r'aRTH'917&.' a%?r§‘G?1?,f%I11T,uwI,3n1%I'a?wH'sWa'%%'a?fi7:g'Frz?ffiafi%%-afii f%Ts‘1fi9§f%r3?34'g’HITf’u‘m1?f¢Ra?ffif%traTnuT%*I3aT:--3rfi?rz3r

1.%mTt%31Trr sf %fi?~rr«rrzrf%Ia1'fr-lg397

(66)

'srm',aHUf%?a?rH'snfE‘If%t%vfiaT3m1?rw:'f%rd?§*m°rw1uT%:si%r

%*3fiT1%Tq°r1¥,3Ifi%?wI¥37I6HrmfiWf%FeTra1fiT%‘l3raT:3I13?rfi€t€

a?q',zé3THsnf?.*91‘aHafiTamfi9r:f3:a1a',TI€?ranfi‘91a'I%H1GraT

3111°r91E.'3'9T‘a‘°rI?fs'?q—>r2ITf%I7=I»‘f%rcr91?r.'2fi%I

fimT%:3rrerr<'qT91E.'°f3u€Ffi7rSI7:fiI‘<'6‘TH?r#r€3*I

1.21’

2.a’rfiI$

3.2fi111fi

I==a:s1E.'a‘*€fs‘fi‘1'r1%aT2i$gT:Ir.*§‘Fr‘e:°rH1?l€IwT -§?vr,a?an1°c.-‘I

'a‘rffi$'a’r31?a'TaTa°rHT2i$6r1ga1I%4TIfifi€s$I3?fi€Ha°rw29(a9r§'q m?:'ei€r§f%ra%3a1%Tw%'zgTq'?aT,a=r¢l%r'aT1?.'I'fi11Ef'm?:'a?a?

13ra7?E1?ri?,€rfiFrsfi$r31?f1?a's1traI2f=?fI1§i%I?ra°rGr1aT%l€?fi, 'q'a»Trr's1?:'arr1%‘si1I3I2f%"a»1:m'I

sI'a°I1T=?I€31T%rI‘<q‘<s1E¥%Efi=r33l‘<'§°rm'r€r%I

1.Fl'HT7=’T

3. 2.

References

Related documents

The CT and CBCT data are transferred to softwares like custom-designed Cad implant software (Praxim, Grenoble, France), DICOM-size to the planning software (co.. Once

• To associate the level of breast engorgement before application of vacuum bottle with selected effectiveness of vacuum bottle extraction with selected demographic variables

Objective: To compare the neonatal outcome of spontaneous and indicated preterm births less than 37 weeks of gestational age in terms of respiratory morbidity , sepsis

The ear is constantly challenged by a variety of microorganisms such as fungi, virus, and bacteria, which is present in the external environment, it is

I hereby declare that this thesis entitled “AMRITHALAL NAGAR KE AITHIHASIK UPANYASOM KA VISHLESHANATHMAK ADHYAYAN” has not previously formed the basis ofany degree,

- Linguistic theorips and their appliration - Counril for cultural co-nneration , Firrt Edition 1967

A com arative study of vocabulary of Hindi and Malayalam th’sis _ Dr,M.Easvari , Firct Edition 1973 Debartment of Hindi, Cochin University of.. Srience

of Science and Technology, Cochin-682022, and no part of this thesis has been included in any other thesis submitted previously for the award of any degree in any other university.

entitled Dr. RAMKUMAR VARHA KA KAVYA has not previously formed the basis of the award of any degree,. diploma, associateship, fellowship or other similar title

The results contained in this thesis have not been submitted to any other University or Institute for the award of any degree or diploma.. and

Teak plantations were initiated in Kerala in 1842, and extended almost continuously. Among plantations raised by the Forest Department, teak occupies the largest area and a

Coming to the Indian context, the concept of judicial review in the Constituent Assembly, initial approach of the Supreme Court of India towards the doctrine, gradual empowerment

Since TMPA is a better electron donor (EOX = 0.57 V vs SCE in DCM) compared to PT (EOX = 0.75 V vs SCE), secondary electron transfer as shown in equation 4.4 is expected to take

Technology, Cochin-682 022 and no part of this thesis has been included in any other thesis submitted previously for the award of any degree in any university.

I hereby declare that the thesis entitled &#34;Hindi aur Angrezi ki vyakaranik sanrachana anuvad ke sandarbh me&#34; has not previously formed the basis of the award of any

I hereby declare that this thesis entitled “HINDI AUR MALAYALAM KE SAMASYA NATAK - THULANATMAK ADHYAYAN” has not previously formed the basis of any degree, diploma,

speculative transactions do not call for the payment of the full price, but can be made by the deposit of a fractional part of the price, the volume of speculative transaction

I here by declare that, the thesis entitled “ HINDI — ANGREZI KAVYANUVAD KI SAMASYAYEM ‘ RAMACHARITMANAS ‘KA ANUVAD, ‘THE RAMAYANA OF THULSIDAS KE VISIIESH.. SANDARBH MEIN “

DEVAKI, Department of Hindi, Cochin University of Science and Technology and that no part of it has been previously formed the basis for the award of any degree, diploma,

This is to certify that this thesis entitled “SAMAKALEEN HINDI – MALAYALAM MAHILA KAHANIKARON KI KAHANIYON MEIN PRATIRODHI CHETANA (2000 SE 2010 TAK KI KAHANIYON KE

nantly silver bellies) had shown a true digestibility of 70 in E, iggiggg, This is slightly lower than the assimilation of protein from fish meal found by Nose (1964) in

I hereby declare that the thesis entitled as “VYAKTHIVADI CHETHANA KE VIVIDH AAYAM AJNEY KE UPANYASOM MEIN” has not previously fonned the basis of the award of any Degree,

guidance and that it has not previously formed the basis for the award of any degree or diploma in the Goa University or elsewhere. Date: W |W2018 Place Taleigao